BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0106 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 27 0.17 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 3.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.6 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 27.1 bits (57), Expect = 0.17 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +2 Query: 389 LPVAVPPRALRNAGLTVQDVSDIT---RAPEMLGGRVKTLH 502 +P PP A +N + D S + AP MLGGR T + Sbjct: 312 MPCTQPPSAPQNLTVNFVDQSTVFLSWNAPHMLGGRTDTTY 352 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 583 SVVVCNLYPFRPDGYLRPDVTVADAVENIDI 675 S+V +PFRP G + D+ N DI Sbjct: 277 SLVASRTWPFRPSGTVLKDINRQVDELNFDI 307 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 454 HHESTGDARRSGENFTSSVHAGIL 525 HH T R SG T + AG+L Sbjct: 539 HHRDTPVVRASGRELTIILLAGVL 562 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 454 HHESTGDARRSGENFTSSVHAGIL 525 HH T R SG T + AG+L Sbjct: 629 HHRDTPVVRASGRELTIILLAGVL 652 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 377 PHSDRLFANESRPVLSETLRRASFPFDAMFCLLK 276 P+ D L+ + S T+ FPFD C++K Sbjct: 135 PNGDVLWVPPAIYQSSCTIDVTYFPFDQQTCIMK 168 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,623 Number of Sequences: 438 Number of extensions: 3673 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -