BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0103 (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51914| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 31 1.4 SB_34003| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53828| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_35036| Best HMM Match : ASC (HMM E-Value=7.8e-12) 29 3.1 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) 29 4.1 SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 29 4.1 SB_33877| Best HMM Match : CDI (HMM E-Value=2.2e-12) 29 5.5 SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_22897| Best HMM Match : C2 (HMM E-Value=4.1e-11) 29 5.5 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_26173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_43065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 28 9.5 >SB_51914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 430 KTRHRRLPEVSR*SREEQKKWNLTKLKEVDNLRPTGNY 543 +TRHR++ +R E W+LT+L V N++P ++ Sbjct: 40 RTRHRKVTSTTRDGHEHDTGWSLTRLGMVKNMKPDPSF 77 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 5/63 (7%) Frame = +2 Query: 170 TQEVKDVKLENGNAPGASNGTSSKSEDSAYLSRK--PSRRFPNLE---IPSPMEKPSRSR 334 ++E + V+ N +P + SSK ++ + PSR P ++ + P EKP RSR Sbjct: 144 SKETQPVQQRNPASPAKKHHRSSKETPTSLAEKPSWPSRETPPVQPRNLAGPAEKPHRSR 203 Query: 335 KAT 343 + T Sbjct: 204 RET 206 >SB_34003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 30.3 bits (65), Expect = 1.8 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 6/113 (5%) Frame = +1 Query: 343 KWMKQAKVIDGKKITTTDTAIXLQKTQIGKTRHRRLPEVSR*SRE----EQKKWNLTK-- 504 K + K+ D KK T D+ I + ++ K++ R S+ +KK+ + Sbjct: 34 KLFRDLKIYD-KKFTQIDSDIIFNRPEV-KSKSERKVNFSQFKAALSLCAEKKYGKREDV 91 Query: 505 LKEVDNLRPTGNYITRYKITGSRSGP*IDLTDTSKYTGSHXAALSMXTGKXEG 663 +K VD + + ++G LTDT KYTGSH TGK G Sbjct: 92 IKLVDKICEGKGPVASKTTKVVKAGAVDRLTDTRKYTGSHKERFD-ETGKGRG 143 >SB_53828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +3 Query: 468 ISRRTKKVELDEIKRS*QLAANRELHHTLQNHR-QP-QRAVDRFDRHKQ 608 +++R K +E + + +L+ + H T+QN R QP QRA + ++H+Q Sbjct: 351 LTKRIKSLETSKAELENRLSVLEKEHETVQNQRKQPIQRAAPKQEQHQQ 399 >SB_35036| Best HMM Match : ASC (HMM E-Value=7.8e-12) Length = 420 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -3 Query: 664 PLPFSQFXSKALPXATQY-----ICLCLSNRSTARCGCR 563 PLP+ +++ P Y + LC S T RCGCR Sbjct: 199 PLPYKSNCTESKPGLRLYSMEGCVALCASQELTRRCGCR 237 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 173 QEVKDVKLENGNAPGASNGTSSKSEDSAYLSRKPSRRFPNLE 298 Q V L+N G S+GT+S+ +S Y S + S +FP+LE Sbjct: 259 QPVDGTVLDNITGLGNSHGTNSELSNSLY-SYQDSMKFPSLE 299 >SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) Length = 233 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 176 EVKDVKLENGNAPGASNGTSSKSEDSAYLSRKPSRRFPNLEIPSPMEKPSRSRKAT 343 E + K E G + G + D A+ + + F LE+PSP + P + +KA+ Sbjct: 7 EAQAKKQEESAENGKNKGKGKRKRDEAHQVNRITFFF--LEVPSPSKSPVKKKKAS 60 >SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 475 EEQKKWNLTKLKEVDNLRPTGNYITRYKITGSR 573 EE W+L + VDN + T Y + Y+I +R Sbjct: 134 EENTYWSLAYYRWVDNYQETKKYYSNYRIPAAR 166 >SB_43457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 29.1 bits (62), Expect = 4.1 Identities = 23/85 (27%), Positives = 35/85 (41%) Frame = +2 Query: 14 NSISATTKSASLKRLSATDSLAYMISSHKYIKHL*RKMSTEAQNTDAAVEQVTQEVKDVK 193 N + T + + D A S++ RK E Q A +EQV QE + VK Sbjct: 369 NLLEQTNRQLHQRNQKLLDECASAFQSYQEAFAAQRKQKLEKQEALAELEQVKQEYEAVK 428 Query: 194 LENGNAPGASNGTSSKSEDSAYLSR 268 +E + S SK+ A +S+ Sbjct: 429 MEVSSL--KSKNADSKTLIKAQISQ 451 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 176 EVKDVKLENGNAPGASNGTSSKSEDSAYLSRKPSRRFPNLEIPSPMEKPSRSRKAT 343 E + K E G + G + D A+ + + F LE+PSP + P + +KA+ Sbjct: 7 EAQAKKQEESAENGKNKGKGKRKRDEAHQVNRITFFF--LEVPSPSKSPVKKKKAS 60 >SB_33877| Best HMM Match : CDI (HMM E-Value=2.2e-12) Length = 228 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +2 Query: 128 STEAQNTDAAVEQVTQEVKDVKLENGNAPGASNGTSSKSEDSAYLSRKPSRR 283 S E N D +E Q +V+ N P T++KS D RKP R Sbjct: 94 SLEQANRDILIEDTQQN--EVQNSQRNVPRCELHTTTKSTDGTVARRKPKSR 143 >SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1097 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/64 (25%), Positives = 29/64 (45%) Frame = +2 Query: 137 AQNTDAAVEQVTQEVKDVKLENGNAPGASNGTSSKSEDSAYLSRKPSRRFPNLEIPSPME 316 A+N ++ KD + + P + + S+ D + RKP + N P+P + Sbjct: 555 AENLFEVSDEENDNDKDNEEDRFFEP-SQEASGSEHSDEEVVDRKPPKNVTNKPPPAPAK 613 Query: 317 KPSR 328 KPS+ Sbjct: 614 KPSK 617 >SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1627 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +3 Query: 30 QRKV--RRLNACPLPTRLHI*YHHTNTLNTYK--EKCLLKHRIR 149 QRK+ N CPLP L + Y H T +Y EK +L+ ++ Sbjct: 565 QRKIVLNAFNRCPLPLYLRLAYDHAVTWKSYTPLEKSVLEKNVQ 608 >SB_22897| Best HMM Match : C2 (HMM E-Value=4.1e-11) Length = 314 Score = 28.7 bits (61), Expect = 5.5 Identities = 22/75 (29%), Positives = 34/75 (45%) Frame = +1 Query: 298 DPKSDGKAITLSQSDKWMKQAKVIDGKKITTTDTAIXLQKTQIGKTRHRRLPEVSR*SRE 477 DPK+ + ++ WM +K KI+ T T+ Q+GKT+ R S E Sbjct: 47 DPKTHAGYLNNVKTQIWMGTSKW--SAKISITGTSDPYVTVQVGKTKKR----TSTIPHE 100 Query: 478 EQKKWNLTKLKEVDN 522 +WN T L + D+ Sbjct: 101 LNPEWNETFLLDEDD 115 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 28.7 bits (61), Expect = 5.5 Identities = 21/63 (33%), Positives = 27/63 (42%) Frame = +2 Query: 209 APGASNGTSSKSEDSAYLSRKPSRRFPNLEIPSPMEKPSRSRKATNG*SKPKSLMXRK*Q 388 +P S S + S+ P RR P SP SRS+ A+ SK KS K Q Sbjct: 653 SPFRERRRSPPRRTSRWSSQSPDRRSPARIKSSPARSRSRSQSASPRHSKSKSPALSKVQ 712 Query: 389 QRT 397 +T Sbjct: 713 VKT 715 >SB_26173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 21 SVQQRKVRRLNACPLPTRLHI*YHHTNTLNTYKEKCLLKHRIRMP 155 ++Q VRR A P P R + YH T T KC ++H + P Sbjct: 906 TIQSVIVRR--ALPWPPRYKV-YHATRANGTTNTKCTMRHALPWP 947 >SB_43065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 50 KRLSAT-DSLAYMISSHKYIKHL*RKMSTEAQNTDAAVEQVTQEVKDVK 193 K + AT SLA + +Y+ +++ST + + + QVT+++ DVK Sbjct: 321 KEMQATKQSLALLKQDKEYLNKQVQELSTRSSLAEEQLGQVTKQLNDVK 369 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 149 DAAVEQVTQEVKDVKLENGNAPGASNGTSSKSEDSAYLSRKP 274 DAA+ Q T E LE+ +A A N + + D+ ++RKP Sbjct: 1179 DAALAQETVEEPLKSLESSHAVNALNHSMNNGGDNTKINRKP 1220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,404,150 Number of Sequences: 59808 Number of extensions: 396984 Number of successful extensions: 1293 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -