BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0100 (784 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-30... 30 1.8 12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-32... 29 4.2 04_04_1078 - 30655212-30655289,30655614-30655811,30655916-306560... 29 4.2 01_01_1154 - 9178427-9178738,9179819-9180874 29 5.5 05_04_0386 + 20822376-20822982,20823715-20824244,20824315-20825127 28 7.3 02_01_0102 - 749122-749799,750123-750371,750753-750851,751380-75... 28 9.6 >11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-305640, 305744-305804,305885-306018,306310-306654 Length = 281 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 400 ELFFDAATEEREHATKLIDYLLMRG 474 + F +++ EER+HA KLI Y MRG Sbjct: 160 KFFKESSDEERDHAEKLIKYQNMRG 184 >12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-320458, 321211-321298,321401-321461,321542-321625,322332-322630 Length = 255 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 290 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFANY 406 C + +QI E AS Y ++ AYF D V GFA + Sbjct: 91 CEAAISEQINVEFNASYAYHSLFAYFDRDNVALKGFAKF 129 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 400 ELFFDAATEEREHATKLIDYLLMRG 474 + F +++ EER+HA KL+ Y MRG Sbjct: 128 KFFKESSDEERDHAEKLMKYQNMRG 152 >04_04_1078 - 30655212-30655289,30655614-30655811,30655916-30656086, 30656172-30656252,30656464-30656565,30656671-30656779, 30656900-30656965,30657566-30657630,30658386-30658475, 30658952-30659123,30659831-30659943,30660046-30660219, 30660300-30660347,30662041-30662205 Length = 543 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 540 GASALEHALKLESDVTNSIREVIKTCESSFQTTTT 644 GAS E K E ++ N +E+ +TC + +QTT T Sbjct: 349 GASGYEETEKAE-EIMNLAKELARTCYNFYQTTPT 382 >01_01_1154 - 9178427-9178738,9179819-9180874 Length = 455 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 514 PPPTRRGRAAHQPSSTPSSWR 576 PPP RR +A H SST W+ Sbjct: 76 PPPPRRKKAGHTSSSTRPRWQ 96 >05_04_0386 + 20822376-20822982,20823715-20824244,20824315-20825127 Length = 649 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 486 LRNRPHHVRAPANTSWESGASALEHALKLESDVTNSIR 599 + P VR+PA S G +AL A + D+T S+R Sbjct: 172 IEQSPEVVRSPAYYSGPDGKTALHAAALVSEDMTESLR 209 >02_01_0102 - 749122-749799,750123-750371,750753-750851,751380-751889, 752025-753905,754093-754296,754807-754899,755036-755122, 755241-755328,755533-755645,755943-757259,757398-758672, 759166-759273 Length = 2233 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 463 LMRG--KLTGSVTDLITSGPPPTRRGRAAHQPSST 561 L RG KL V DLI SGPPP + + P T Sbjct: 460 LKRGDKKLPPEVLDLIMSGPPPDSQAQQVSGPPVT 494 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,904,995 Number of Sequences: 37544 Number of extensions: 412264 Number of successful extensions: 1276 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1276 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -