BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0099 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 1.1 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 24 6.0 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 745 HXIRGTAAKANGPXRIPFSYKRVFFSQEGAQKSYHQGIXG 626 H + G AKA+ P F Y R ++ + + +QG+ G Sbjct: 1767 HVMSGMVAKAH-PSCEGFPYSRTIYANDPTENKQYQGLPG 1805 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 771 DFDPECFQFTP*GELPQKPT 712 DF C TP G LP PT Sbjct: 410 DFRHNCRPLTPGGTLPHNPT 429 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,867 Number of Sequences: 2352 Number of extensions: 16704 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -