BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0099 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 26 0.34 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.4 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.5 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.5 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.5 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.5 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 5.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 26.2 bits (55), Expect = 0.34 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 Query: 4 IRHESLNRSQHDAALPSTTPRQERKSST 87 I+ ++N+ Q + TTP++ERK++T Sbjct: 772 IKPANVNKEQSPNSTKETTPKKERKTAT 799 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 5 FGTRVSTDRSTTLLYRAQHPARNGSRLQTIPSPD 106 FG+R +R T ++R + NGS + SP+ Sbjct: 294 FGSRFDEERLTLRIHRGRGSVHNGSNNGSPRSPE 327 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 389 ALGRAAGGAKLPSAGLCLNASKAEASL 309 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 389 ALGRAAGGAKLPSAGLCLNASKAEASL 309 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 389 ALGRAAGGAKLPSAGLCLNASKAEASL 309 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 389 ALGRAAGGAKLPSAGLCLNASKAEASL 309 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 363 RTTGRSAECMNQMSETAVPLVLSS 434 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 14 RVSTDRSTTLLYRAQHPARNGSRLQTIPSP 103 +VS DR++ + YR +PA +Q+ PSP Sbjct: 415 QVSPDRTSPMEYRLYNPA----LIQSQPSP 440 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 9 ARESQQIAARRCSTEHNTPPGT 74 A S Q + +R STE P GT Sbjct: 531 AIRSGQTSVQRASTEFGIPTGT 552 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,730 Number of Sequences: 438 Number of extensions: 4936 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -