BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0099 (772 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.5 At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic... 28 5.9 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -3 Query: 491 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 315 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 314 SLAESGKD 291 S GK+ Sbjct: 692 SPDSGGKE 699 >At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 516 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 274 PESREALTM*LY*SRFAFKTRDATSKPIWIAEXDAI 167 P++ LT Y SRFAF + ++ + IW+ E D I Sbjct: 301 PQTENNLTFAAYSSRFAFPSNESADQYIWL-ESDLI 335 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,337,679 Number of Sequences: 28952 Number of extensions: 363869 Number of successful extensions: 885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -