BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbpv0096
(455 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At1g18960.1 68414.m02359 myb family transcription factor contain... 28 2.6
>At1g18960.1 68414.m02359 myb family transcription factor contains
Pfam profile: PF00249 myb-like DNA-binding domain;
contains similarity to transcription factor GI:9759592
from [Arabidopsis thaliana]
Length = 307
Score = 28.3 bits (60), Expect = 2.6
Identities = 18/54 (33%), Positives = 23/54 (42%)
Frame = -1
Query: 434 IIDEIPAKCSEKIARSTDLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGG 273
I +P K E++ + L L E G H PFS +L E NI GG
Sbjct: 85 IAQHLPGKTEEEVKMFWNTKLKKKLSEMG--IDHVTHRPFSHVLAEYGNINGGG 136
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,989,379
Number of Sequences: 28952
Number of extensions: 141067
Number of successful extensions: 265
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 265
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 752336160
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -