BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0093 (749 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 29 4.4 At4g33985.1 68417.m04822 expressed protein 29 4.4 At3g16370.1 68416.m02071 GDSL-motif lipase/hydrolase family prot... 28 5.8 At3g51310.1 68416.m05616 vacuolar protein sorting-associated pro... 28 7.6 At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) fa... 28 7.6 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%) Frame = -2 Query: 391 LPTVPGIEAVTFVNFLSAFRCLSNVVSQE--VGALNV--AVFAWTGAFAAQYRSLIWNNP 224 LP + I + T + +A L +V S++ VG ++ T A+A L+W++P Sbjct: 348 LPYLQNIVSETLRLYPAAPMLLPHVASKDCKVGGYDMPRGTMLLTNAWAIHRDPLLWDDP 407 Query: 223 *SFEPLRF 200 SF+P RF Sbjct: 408 TSFKPERF 415 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 83 HEMRSRA*AEETWLRRKSHEELGMSGRAR 169 H A EE WLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At3g16370.1 68416.m02071 GDSL-motif lipase/hydrolase family protein similar to family II lipases EXL3 GI:15054386, EXL1 GI:15054382, EXL2 GI:15054384 from [Arabidopsis thaliana]; contains Pfam profile: PF00657 Lipase Acylhydrolase with GDSL-like motif Length = 353 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -3 Query: 684 SKRLRARFEYAICVLSASFLTFLDNVKVNLNLYRV 580 SK+ + + AIC+LSA F+ N VN LY+V Sbjct: 150 SKKADSIIKGAICLLSAGSSDFVQNYYVNPLLYKV 184 >At3g51310.1 68416.m05616 vacuolar protein sorting-associated protein 35 family protein / VPS35 family protein similar to vacuolar protein sorting 35 [Mus musculus] GI:11875394; contains Pfam profile PF03635: Vacuolar protein sorting-associated protein 35 Length = 783 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -3 Query: 552 GRCSNYIQISLNFYLKTRTKHTGLFRGDRIESLAEVHSGI*QLLISGKEPW 400 G S Y+++ LN YL K GD I+SLAE+ + + SG EP+ Sbjct: 702 GSVSLYVEL-LNKYLYFLEKGNQQVTGDTIKSLAELIKSETKKVESGAEPF 751 >At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 240 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Frame = +2 Query: 230 VPDQRPVLGSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHR--FDAWYGWK--NH 397 +P ++ V S+ S + C V D I +C + K HR DAW+ K N Sbjct: 56 IPPEKEVSLSRNGSSHEQCRVCLQDKEEVLIELGCQCRGGLAKAHRSCIDAWFRTKGSNQ 115 Query: 398 CQ 403 C+ Sbjct: 116 CE 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,559,933 Number of Sequences: 28952 Number of extensions: 275539 Number of successful extensions: 660 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -