BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0091 (776 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 26 0.45 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.2 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 25.8 bits (54), Expect = 0.45 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 369 EVVVPP*AYTDEGVELGGAKELSNYVFTMDEQCRTEF 479 E+++P A T G E+G + Y + + + CRT F Sbjct: 380 EMILPGVAVTYYGEEIGMVDNTTIYKYDVRDGCRTPF 416 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 114 GLQDSPP*VGSAPKRGQPPS 173 G Q SP AP+RG PP+ Sbjct: 22 GPQPSPHQSPQAPQRGSPPN 41 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 147 QTPPTGANPEGPPS 106 Q PP G P PPS Sbjct: 44 QGPPPGGPPGAPPS 57 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,873 Number of Sequences: 438 Number of extensions: 5323 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -