BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0087 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 6.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 6.5 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 6.5 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 8.7 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 8.7 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 532 HRAGVHHH 555 HRAG+HHH Sbjct: 495 HRAGLHHH 502 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -1 Query: 153 LVHRFLASLGKNLSVIAYFLFDFVIXHLRFIVVFRK 46 L H+F +LG N + + + D H F FR+ Sbjct: 2397 LYHKFATALGHNSADVQSYKIDANGNHQHFYTGFRR 2432 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -1 Query: 153 LVHRFLASLGKNLSVIAYFLFDFVIXHLRFIVVFRK 46 L H+F +LG N + + + D H F FR+ Sbjct: 2398 LYHKFATALGHNSADVQSYKIDANGNHQHFYTGFRR 2433 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.4 bits (48), Expect = 6.5 Identities = 12/44 (27%), Positives = 17/44 (38%) Frame = +3 Query: 240 PELPSPHRPSAFHRCQLNTSERDKIEC*QPWLVEMNARPPTRPI 371 P+L S H CQ S + K C P+ + P P+ Sbjct: 109 PDLQSHHELKPIETCQYPFSAKQKEVCINPYHYKRVESPVLPPV 152 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 8.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 532 HRAGVHHHCFIIINSWTSLYYNFFIPCHLSNQKFAFL 642 H+ GV+ + FI+ N+ LY+ P ++Q A L Sbjct: 529 HKLGVNGYAFIVDNNGRVLYHPDLRPLSDNDQYSATL 565 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 210 TSNTCPRRQVPELPSPHRPSAFHRCQLN 293 T CP R +LPS +RP +C N Sbjct: 63 THYCCPDRS-EQLPSRNRPKLLTQCDSN 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 716,110 Number of Sequences: 2352 Number of extensions: 15007 Number of successful extensions: 76 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -