BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0084 (858 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 28.7 bits (61), Expect = 6.4 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 12 PRAARXAEPKXVRPGQSLTVECLVEGA*NSR--RHLEIRQGNLLARVEIRGPVLVF 173 PR + K VR G+S +EC G+ R + + ++ L ARV G +LVF Sbjct: 497 PRFMQSMVSKRVRTGESAVLECKASGSPMPRFTWYKDDKKVTLSARVVAHGQLLVF 552 >SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1496 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 6 GSPRAARXAEPKXVRPGQSLTVECLVEG 89 GSP AR A+ V G LT++C+ G Sbjct: 67 GSPTIARIADNATVLTGSRLTIDCVATG 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,040,471 Number of Sequences: 59808 Number of extensions: 366684 Number of successful extensions: 529 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -