BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0083 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 53 2e-07 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 53 2e-07 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 47 9e-06 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 46 2e-05 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 46 3e-05 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 42 3e-04 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 41 6e-04 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 40 0.002 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 39 0.003 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 39 0.003 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 39 0.003 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 39 0.003 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 39 0.003 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 39 0.003 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 38 0.004 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 38 0.004 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 38 0.006 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 38 0.006 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 37 0.010 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 37 0.010 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 37 0.013 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 37 0.013 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 36 0.018 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 36 0.018 At2g47310.1 68415.m05906 flowering time control protein-related ... 36 0.018 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 36 0.023 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 36 0.023 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 36 0.023 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 36 0.031 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.031 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 36 0.031 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 35 0.041 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 35 0.041 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 35 0.041 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 35 0.054 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 35 0.054 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 35 0.054 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 34 0.071 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.071 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.071 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 34 0.071 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 34 0.071 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 34 0.071 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 34 0.071 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 34 0.071 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 34 0.071 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 34 0.094 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.094 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 34 0.094 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 34 0.094 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 34 0.094 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 34 0.094 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 33 0.12 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 33 0.12 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 33 0.12 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 33 0.12 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 33 0.12 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.16 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 33 0.16 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 33 0.16 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 33 0.16 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 33 0.16 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 33 0.16 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 33 0.16 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 0.22 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 33 0.22 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 32 0.29 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 32 0.29 At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing ... 32 0.29 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 32 0.29 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 32 0.29 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 32 0.29 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 32 0.29 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 32 0.38 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 32 0.38 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 32 0.38 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 32 0.38 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 32 0.38 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 32 0.38 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 31 0.50 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 31 0.50 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 31 0.50 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 31 0.50 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.50 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 31 0.50 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 0.66 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 31 0.88 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 31 0.88 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 31 0.88 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 31 0.88 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 31 0.88 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 30 1.2 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 30 1.2 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 30 1.2 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 30 1.2 At1g47620.1 68414.m05289 cytochrome P450, putative similar to cy... 30 1.5 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 29 2.0 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 29 2.0 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 29 2.0 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 29 2.0 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 29 2.0 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 29 2.0 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 29 2.0 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 2.0 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 29 2.0 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 29 2.0 At5g47850.1 68418.m05912 protein kinase, putative contains simil... 29 2.7 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 29 2.7 At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing ... 29 2.7 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 29 2.7 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 29 2.7 At1g30680.1 68414.m03751 toprim domain-containing protein contai... 29 2.7 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 29 3.5 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 29 3.5 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 29 3.5 At2g40800.1 68415.m05033 expressed protein 29 3.5 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 29 3.5 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 29 3.5 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 29 3.5 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 29 3.5 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 29 3.5 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 29 3.5 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 29 3.5 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 28 4.7 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 28 4.7 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 28 4.7 At5g51300.2 68418.m06360 splicing factor-related contains simila... 28 4.7 At5g51300.1 68418.m06359 splicing factor-related contains simila... 28 4.7 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 28 4.7 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 28 4.7 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 28 4.7 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 28 4.7 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 28 4.7 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 28 4.7 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 28 4.7 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 28 4.7 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 28 6.2 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 28 6.2 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 28 6.2 At5g03480.1 68418.m00304 expressed protein ; expression support... 28 6.2 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 28 6.2 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 28 6.2 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 28 6.2 At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identic... 28 6.2 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 28 6.2 At1g07600.1 68414.m00813 metallothionein-like protein 1A (MT-1A)... 28 6.2 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 27 8.2 At4g19670.1 68417.m02889 zinc finger (C3HC4-type RING finger) fa... 27 8.2 At3g53830.1 68416.m05947 regulator of chromosome condensation (R... 27 8.2 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 27 8.2 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +3 Query: 108 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR TG Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTG 54 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/41 (51%), Positives = 33/41 (80%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 +SRGFAFVR+ + +A +A++ +DGR++D RE+ VQ A+YG Sbjct: 55 DSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +3 Query: 108 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR TG Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTG 54 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/41 (51%), Positives = 33/41 (80%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 +SRGFAFVR+ + +A +A++ +DGR++D RE+ VQ A+YG Sbjct: 55 DSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 47.2 bits (107), Expect = 9e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 SL V NL + EDLRR FE+ G V DIY+PRD YTG Sbjct: 38 SLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTG 75 Score = 37.1 bits (82), Expect = 0.010 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 + RGF F++F + DA EA MDG +L REL V A Sbjct: 76 DPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFA 113 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 46.0 bits (104), Expect = 2e-05 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 SL V NL + EDLR+ FE+ G V DIY+PRD YTG Sbjct: 37 SLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTG 74 Score = 35.9 bits (79), Expect = 0.023 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 + RGF FV+F + DA +A MDG +L REL V A Sbjct: 75 DPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFA 112 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 SL V N+ PE+LR FER G V D+YIPRD Y+G+ Sbjct: 48 SLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQ 86 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 + RGFAFV F + DA EA +M+ R RE+ V +A Sbjct: 86 QPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVA 123 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +3 Query: 135 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 G L + NL P DLR FER G + DIY+PR+ YTG+ Sbjct: 45 GPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGE 86 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 E RGF FV++ DA EA+ M+ +++ RE+ + A Sbjct: 86 EPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFA 123 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V NLT+RTT +DLRR FE+ G+V D + + Y G+ Sbjct: 16 VGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGR 51 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 R+SRG AFV + R DA +A +MD ++L+ R+L V +A Sbjct: 95 RQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIA 133 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 SRGF FV F ++DA+ A++ M+G+ L R++R A G Sbjct: 184 SRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWATKG 223 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/59 (25%), Positives = 33/59 (55%) Frame = +2 Query: 194 PRFRKVRRSW*YLHSQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 P +++ S + S + + ++ + FV +F+RR A A+ +++GR L + ++V A Sbjct: 73 PLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRHLFGQPIKVNWA 131 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 G+AFV F + RDAE+A+ DG D LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 G+AFV F + RDAE+A+ DG D LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 G+AFV F + RDAE+A+ DG D LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/37 (54%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F E DA A D MDG+ L R LR+ A Sbjct: 81 SRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = +2 Query: 251 HRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 +++ R F FV F ER DA A+D MDG L R L V A Sbjct: 50 NQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYA 89 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/42 (38%), Positives = 29/42 (69%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 + S+G+AF++F + DA A++TMD RM + R + + +A+ G Sbjct: 78 KRSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDIAKPG 119 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 SRGF FV F ++DA+ A+D + G+ L R++R A G Sbjct: 179 SRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCNWATKG 218 Score = 32.3 bits (70), Expect = 0.29 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +2 Query: 230 LHSQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 + S + + +E + FV +F+RR A A+ +++GR L + ++V A Sbjct: 80 VESCKLIRKEKSSYGFVHYFDRRSAGLAILSLNGRHLFGQPIKVNWA 126 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 SRGF FV F ++DA+ A++ M+G+ + R++R A G Sbjct: 192 SRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKG 231 Score = 32.7 bits (71), Expect = 0.22 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +2 Query: 230 LHSQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 + S + + ++ + FV +F+RR A A+ T++GR + + ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 SRGF FV F ++DA+ A++ M+G+ + R++R A G Sbjct: 188 SRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKG 227 Score = 32.7 bits (71), Expect = 0.22 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +2 Query: 230 LHSQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 + S + + ++ + FV +F+RR A A+ T++GR + + ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 G+AFV F + RDA++A+ DG D LRV++A G Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELAHGG 83 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 G+AFV F + RDA++A+ DG D LRV++A G Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELAHGG 83 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 36.7 bits (81), Expect = 0.013 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F A A+ MDG+ L+ R++RV +A Sbjct: 75 SRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 36.7 bits (81), Expect = 0.013 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F A A+ MDG+ L+ R++RV +A Sbjct: 75 SRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 36.3 bits (80), Expect = 0.018 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 123 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 P+ + +L V L+ RTT E LR F + GEV D + DR +G Sbjct: 50 PQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSG 94 Score = 31.5 bits (68), Expect = 0.50 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+GF FVR+ D+ + + MDG+ LD + + AR Sbjct: 96 SKGFGFVRYATLEDSAKGIAGMDGKFLDGWVIFAEYAR 133 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 36.3 bits (80), Expect = 0.018 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F R DA+ A++ ++G D LRV+ A Sbjct: 253 SRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWA 289 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 36.3 bits (80), Expect = 0.018 Identities = 17/44 (38%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +3 Query: 132 DGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 DG ++ L V ++ T D+R+VFE+ G V +I +P+D+ TG+ Sbjct: 106 DGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGE 149 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 35.9 bits (79), Expect = 0.023 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +GF F+ F DA +AL ++DG+++D R + V++A+ Sbjct: 48 KGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEVAK 84 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 35.9 bits (79), Expect = 0.023 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF F+ F E++ +EA+ M+G LD R + V A+ Sbjct: 47 SRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQ 84 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 35.9 bits (79), Expect = 0.023 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRG+ FV + + + E AL+++DG L+ R +RV +A+ Sbjct: 217 SRGYGFVCYSSKAEMETALESLDGFELEGRAIRVNLAQ 254 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 +SRGFAFV D +D +DG R L+V A Sbjct: 124 QSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFA 161 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L V NL++ T E L F CG+V + D TG+ Sbjct: 179 LFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGR 216 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.5 bits (78), Expect = 0.031 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F + A A+ MDG+ L+ R +RV A Sbjct: 75 SRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.5 bits (78), Expect = 0.031 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F + A A+ MDG+ L+ R +RV A Sbjct: 75 SRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 35.5 bits (78), Expect = 0.031 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +3 Query: 99 KMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 K S G P +DG + + NL + TT D+R++F C + + + +++ TG+ Sbjct: 248 KTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGE 300 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 35.1 bits (77), Expect = 0.041 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 SRGF FV + +AE A+ MDG+ L+ R + V++ G Sbjct: 43 SRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKLFGIG 82 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 269 FAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 + FV F RDAE+A+ DG LD LRV++A G Sbjct: 47 YCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELAHGG 83 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 G+AFV F + RDA++A+ DG D LRV++A G Sbjct: 46 GYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIAHGG 83 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 34.7 bits (76), Expect = 0.054 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 R+S G+ +V F + DA+ A++ M+G+ D R + V+ + G Sbjct: 115 RQSLGYGYVWFNSKEDAQSAVEAMNGKFFDGRFILVKFGQPG 156 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQ 364 SRGF FV F R DA+ A++ ++G D LRV+ Sbjct: 214 SRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVE 248 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 34.7 bits (76), Expect = 0.054 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+GF FV + ++ + A+ ++DG LD R++RV A Sbjct: 244 SKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEA 280 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 SRGF FV + E A +G LD R LRV Sbjct: 131 SRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRV 164 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV F + + +A++ M+G+ LD R + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L + T EDL+R F + G+V D I DR +G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV F + + +A++ M+G+ LD R + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L + T EDL+R F + G+V D I DR +G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV F + + +A++ M+G+ LD R + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L + T EDL+R F + G+V D I DR +G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV + + EA+ +DG+ L+ R +RV +A Sbjct: 284 SRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVA 320 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 R +AFV F + RDA++A +DGR D + V+ +R Sbjct: 3 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 39 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 R +AFV F + RDA++A +DGR D + V+ +R Sbjct: 44 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 80 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV F + + ++A++ M+G+ LD R + V A+ Sbjct: 48 SRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 34.3 bits (75), Expect = 0.071 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV F + + ++A++ M+G+ LD R + V A+ Sbjct: 48 SRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 34.3 bits (75), Expect = 0.071 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +2 Query: 275 FVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 FV FF+ RDA +AL M+G+++ + + +Q +R G Sbjct: 223 FVEFFDVRDAAKALRVMNGKVISGKPMVIQFSRPG 257 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 33.9 bits (74), Expect = 0.094 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQ 364 ESRGFAF+ F A A+ MDGR++ + L VQ Sbjct: 55 ESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQ 90 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.094 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 108 YGRPPPRIDGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 245 YGR P G+ + + V L + +DLR F R G + D YIP+D Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKD 274 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 186 DLRRVFERCGEVGDIYIPRDRYTGK 260 D R FER GE+ D+Y+P+D Y K Sbjct: 106 DFRSHFERYGEITDLYMPKD-YNSK 129 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 33.9 bits (74), Expect = 0.094 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+ F FV + + A+ A+D M+GR L ++L+VQ+ R Sbjct: 389 SKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQLKR 426 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.9 bits (74), Expect = 0.094 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF F+ F + + AL TM+G ++ R LR+ +A Sbjct: 259 SRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.094 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.094 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 R +AFV F + RDA++A +DGR D + V+ +R Sbjct: 44 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 80 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 R +AFV F + RDA++A +DGR D + V+ +R Sbjct: 3 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 39 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 L + NL ++ P D++ VF G V D++IP++ TG Sbjct: 333 LIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETG 369 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARY 376 E RGFAFV+F + D A++ +G + R + V+ A + Sbjct: 59 EHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAH 98 Score = 31.9 bits (69), Expect = 0.38 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 +GFAFV+F ++DA A+ +G M R + V A Sbjct: 372 KGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAVDWA 407 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 33.5 bits (73), Expect = 0.12 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +3 Query: 105 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 SY R P + V L + T +++RR FE+ GE+ + I D+ TGK Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 33.5 bits (73), Expect = 0.12 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +3 Query: 105 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 SY R P + V L + T +++RR FE+ GE+ + I D+ TGK Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.1 bits (72), Expect = 0.16 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F A A+ +DGR L R ++V A Sbjct: 80 SRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYA 116 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L + + Y + LR F + GEV D + DR TG+ Sbjct: 42 LFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGR 79 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 251 S+ V N+ Y TPE++++ F+ CG V + I D++ Sbjct: 104 SIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF 139 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+GF FV ++ ++A+++++G LD R++RV A Sbjct: 289 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 325 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Frame = +3 Query: 12 CDAVVLY*SEF-NNIVLLNSFDLS*ISILFKMSYGRPPPRIDGMVSLK--VDNLTYRTTP 182 C + Y S F N+ + + F++ + P R LK V NL++ Sbjct: 53 CSSPAEYPSRFVRNVAVSSDFEVEEDDMFADGDDSAPVERNSFSPDLKLFVGNLSFNVDS 112 Query: 183 EDLRRVFERCGEVGDIYIPRDRYTGK 260 L ++FE G V + + D+ TG+ Sbjct: 113 AQLAQLFESAGNVEMVEVIYDKVTGR 138 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+GF FV ++ ++A+++++G LD R++RV A Sbjct: 297 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 333 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Frame = +3 Query: 12 CDAVVLY*SEF-NNIVLLNSFDLS*ISILFKMSYGRPPPRIDGMVSLK--VDNLTYRTTP 182 C + Y S F N+ + + F++ + P R LK V NL++ Sbjct: 53 CSSPAEYPSRFVRNVAVSSDFEVEEDDMFADGDDSAPVERNSFSPDLKLFVGNLSFNVDS 112 Query: 183 EDLRRVFERCGEVGDIYIPRDRYTGK 260 L ++FE G V + + D+ TG+ Sbjct: 113 AQLAQLFESAGNVEMVEVIYDKVTGR 138 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +3 Query: 123 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 245 P G L V NL + +DLR+VFE G V + +PRD Sbjct: 279 PYSGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD 319 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 V +GFAF+R+ +A +A+ M G+ LD R + V+ A+ Sbjct: 113 VANRPKGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVEEAK 154 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +3 Query: 87 SILFKMSYGRPPPRIDG-MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 S L S PP G L V L++RTT + LR FE+ G + + + D+ + Sbjct: 58 SCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANR 116 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +S+GF FV F DA A+D ++G+ D +E V A+ Sbjct: 262 KSKGFGFVNFENSDDAARAVDALNGKTFDDKEWFVGKAQ 300 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRG FV F +A A+ M+G+M+ + L V +A+ Sbjct: 366 SRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVALAQ 403 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 +S+G+ FV++ A+ A+D ++G +L+ +++ V Sbjct: 171 QSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYV 205 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+G+ FVRF + + AL M+G R++RV +A Sbjct: 243 SKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIA 279 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 32.7 bits (71), Expect = 0.22 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGFAFV F +A A+ +DG+ L R +RV A Sbjct: 74 SRGFAFVTFTSTEEASNAMQ-LDGQDLHGRRIRVNYA 109 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V ++Y T LR F + GEV D I DR TG+ Sbjct: 38 VGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGR 73 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 32.3 bits (70), Expect = 0.29 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 236 SQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S R R SRGF FV+ + A+ +DG+ L+ R ++V +A Sbjct: 240 SDRETGR-SRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVNVA 283 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +3 Query: 114 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 R P D + V NL + L R+F G+V D + DR TG+ Sbjct: 198 RQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGR 246 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 32.3 bits (70), Expect = 0.29 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +3 Query: 105 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVE 266 +Y PP ++ V NL T E+L++ F + GEV + IP + G V+ Sbjct: 225 AYVAPPESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQ 278 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+G+ FV+F E + A+ M+G R +R+ A Sbjct: 157 SKGYGFVKFAEESERNRAMAEMNGLYCSTRPMRISAA 193 >At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing protein similar to Tat-SF1 - Homo sapiens, GI:1667611; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 519 Score = 32.3 bits (70), Expect = 0.29 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQM 367 +G VRF +RRDA++ ++ M+GR R++ + Sbjct: 454 QGVVLVRFKDRRDAQKCIEAMNGRWYAKRQIHASL 488 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.3 bits (70), Expect = 0.29 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF F+ F +RR +E++ M GR R + V A Sbjct: 47 SRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRA 83 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 32.3 bits (70), Expect = 0.29 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 183 EDLRRVFERCGEVGDIYIPRDRYTG 257 ++LR F +CGEV +++P DR TG Sbjct: 497 KELRSHFSKCGEVTRVHVPTDRETG 521 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+G+ FVRF + + A+ M+G R++RV +A Sbjct: 254 SKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIA 290 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 32.3 bits (70), Expect = 0.29 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV + +A AL M+G+M+ + L + +A+ Sbjct: 371 SRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALAQ 408 Score = 29.9 bits (64), Expect = 1.5 Identities = 10/34 (29%), Positives = 24/34 (70%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 S+G+ FV+F + A+ A+D ++G +++ +++ V Sbjct: 175 SKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFV 208 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +2 Query: 275 FVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 FV F++ RDA A D M+G+ + +++ ++ +R G Sbjct: 253 FVEFYDVRDAARAFDRMNGKEIGGKQVVIEFSRPG 287 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 31.9 bits (69), Expect = 0.38 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQ 364 S+GF FV F + A+D M+G+ LD R + Q Sbjct: 84 SKGFRFVTFKDEDSMRTAIDRMNGQELDGRNITAQ 118 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.9 bits (69), Expect = 0.38 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 105 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 SY R P + V L + T +++RR F++ GE+ + I D+ TGK Sbjct: 5 SYYRSPFGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGK 56 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 RESRGF F+ DA + ++D +L R + V+ AR Sbjct: 113 RESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKAR 152 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 31.9 bits (69), Expect = 0.38 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+ F F+ + + A+ A++TM+G L ++L+VQ+ R Sbjct: 379 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 416 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 31.9 bits (69), Expect = 0.38 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+ F F+ + + A+ A++TM+G L ++L+VQ+ R Sbjct: 370 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 407 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 31.5 bits (68), Expect = 0.50 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 251 S+ V N+ Y TPE++++ F+ CG V + I D++ Sbjct: 93 SVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKF 128 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 31.5 bits (68), Expect = 0.50 Identities = 12/37 (32%), Positives = 25/37 (67%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +GF F+ F DA++AL ++G++++ R + V+ A+ Sbjct: 107 KGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAK 143 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.5 bits (68), Expect = 0.50 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 251 S+ V N+ Y TPE+++ F+ CG V + I D++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF 125 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 31.5 bits (68), Expect = 0.50 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 251 S+ V N+ Y TPE+++ F+ CG V + I D++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF 125 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.50 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +S+GF FV F DA A+++++G D +E V A+ Sbjct: 67 KSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQ 105 Score = 30.7 bits (66), Expect = 0.88 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 242 RSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 R + S+G FV F +A EA+ + G+M++ + L V +A+ Sbjct: 165 RDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQ 208 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 31.5 bits (68), Expect = 0.50 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +G+AF+ + RD + A DG+ +D R + V + R Sbjct: 179 KGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDVER 215 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L + T EDL+R F + G+V D I DR +G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 30.7 bits (66), Expect = 0.88 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRG+ FV F A A+ M+G+ L+ + V +A+ Sbjct: 71 SRGYGFVNFISEDSANSAISAMNGQELNGFNISVNVAK 108 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 V S+GF FV F +A++AL +G+ L+ R + V A+ Sbjct: 70 VSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAK 111 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.7 bits (66), Expect = 0.88 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDI 230 L N+ + +TPED+R +FE+ G V DI Sbjct: 96 LIAQNVPWTSTPEDIRSLFEKYGSVIDI 123 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 96 FKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 F+M G + + V L + T + +RR FE+ GE+ + + D+ TG+ Sbjct: 7 FQMEGGNNNTTDTKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGR 61 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +SR F FV F + A A++ M+G ++D +EL V A+ Sbjct: 157 KSRRFGFVNFEKAEAAVTAIEKMNGVVVDEKELHVGRAQ 195 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+G FV F +A +A+ M+G+M+ + + V +A+ Sbjct: 262 SKGVGFVEFSTSEEASKAMLKMNGKMVGNKPIYVSLAQ 299 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/43 (32%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +2 Query: 242 RSVHR--ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQ 364 R++H ++RGF V +++ R A++A + GR+L R+L ++ Sbjct: 238 RALHTAGKNRGFIMVSYYDIRAAQKAARALHGRLLRGRKLDIR 280 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLD--XRELRVQMAR 373 SRGFAFV F+ DA +AL+ + L+ + LRV A+ Sbjct: 498 SRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V + + T DL VF + GE+ D+ + RD+ TGK Sbjct: 40 VGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGK 75 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/35 (31%), Positives = 24/35 (68%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 +S+GFAF+ + ++R A+D ++G ++ R ++V Sbjct: 75 KSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKV 109 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 S+G+ FV+F + A+ A+D ++G +L+ +++ V Sbjct: 171 SKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFV 204 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 SRGF FV + +A A+ M+G+M+ + L V +A+ Sbjct: 367 SRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQ 404 >At1g47620.1 68414.m05289 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 520 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 139 WSR*K*IILPTERR-LKTYAAFSKGAEKLVISTFPEIGTQG 258 W K I + TE++ LK +A F + EK++ + E+G+QG Sbjct: 235 WKLQKWIGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQG 275 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 S+G+ FVRF + + A+ M+G+ R +R+ Sbjct: 195 SKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRI 228 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 251 L V +L + T +++ +F + G V D+Y+ RD Y Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEY 247 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 230 LHSQRSVHRESRGFAFVRFFERRDAEEALDTMDG 331 ++ R +R+SRG FV++ + A A+D ++G Sbjct: 240 VYLMRDEYRQSRGCGFVKYSSKETAMAAIDGLNG 273 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 141 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L V ++ T E++R FE+ G V ++ + +D+ TG+ Sbjct: 120 VKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQ 159 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 251 L V +L + T +++ +F + G V D+Y+ RD Y Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEY 247 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 230 LHSQRSVHRESRGFAFVRFFERRDAEEALDTMDG 331 ++ R +R+SRG FV++ + A A+D ++G Sbjct: 240 VYLMRDEYRQSRGCGFVKYSSKETAMAAIDGLNG 273 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 141 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L V ++ T E++R FE+ G V ++ + +D+ TG+ Sbjct: 120 VKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQ 159 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 R +AFV F DA A++++ G L LR++ A+ Sbjct: 58 RSYAFVNFNHDEDAFAAIESLQGFPLSGNPLRIEFAK 94 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF FV F +A++A++++ G L ++L V A Sbjct: 241 SRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFVGKA 277 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 343 R R FAFV+F + DA +ALD T + ++LD Sbjct: 100 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 130 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 245 SVHRESRGFAFVRFFERRDAEEALDTMDGRML--DXRELRVQMAR 373 S+H ++ G+AFV F + RDAE+A+ D R+L V+ A+ Sbjct: 4 SLHIDA-GYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLSVEWAK 47 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 343 R R FAFV+F + DA +ALD T + ++LD Sbjct: 126 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 156 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRML--DXRELRVQMAR 373 G+AFV F + RDAE+A+ D R+L V+ A+ Sbjct: 36 GYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLSVEWAK 73 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVEDSPS*GFSSVVMLKK 311 V +L + EDL++VF GEV ++ I ++ T K + S F++V K+ Sbjct: 218 VGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKR 270 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 ++RGFAFV +A+ A+D D + R + V AR Sbjct: 133 KNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFAR 171 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 SRGF F+ + ++ A+++M G+ L R++ V A Sbjct: 153 SRGFGFISYDSFEASDAAIESMTGQYLSNRQITVSYA 189 >At5g47850.1 68418.m05912 protein kinase, putative contains similarity to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966; contains protein kinase domain, Pfam:PF00069 Length = 751 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 533 CERERPLEPLSQSESDCGN 477 C RE P PLS S+S CGN Sbjct: 315 CRRECPYRPLSGSQSLCGN 333 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGR 334 V R G+AF+ F + RDA +A+ +DG+ Sbjct: 33 VARRPPGYAFLDFEDPRDARDAIRALDGK 61 >At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 198 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 186 DLRRVFERCGEVGDIYIPRDR 248 +L+++F CGE+ D++IP R Sbjct: 42 ELKKLFSPCGEITDVHIPETR 62 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +S+GF FV F +A +A+ T G+M + L V +A+ Sbjct: 342 KSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIAQ 380 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 251 HRESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 +R RG+AFV F DA A +T++G + L V A+ Sbjct: 237 NRLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRAQ 277 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 105 SYGRPPPR--IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVE 266 S GRP P+ ++G + L V + T ED+ F GE+ ++ + DR +G V+ Sbjct: 82 SDGRPGPQRSVEGWIIL-VSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVK 136 >At1g30680.1 68414.m03751 toprim domain-containing protein contains Pfam profile: PF01751 toprim domain Length = 709 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 213 GEVGDIYIPRDRYTGKVEDSP 275 G++GD Y+ DR TG DSP Sbjct: 675 GQIGDAYLCYDRTTGSYSDSP 695 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRM 337 R+S G+ +V F + DA+ A++ M+G++ Sbjct: 96 RQSLGYGYVWFNSKEDAQSAVEAMNGKV 123 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L V +++ T + LR F GEV + RD+ TG+ Sbjct: 8 LFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGR 45 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRML--DXRELRVQMAR 373 G+AFV F + RDAE+A+ +D + R L V+ A+ Sbjct: 36 GYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAK 73 >At2g40800.1 68415.m05033 expressed protein Length = 377 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 355 KLPAVQHSSVHRVQGFFSITTLEKPYEGESSTFPVYR 245 +L + + S +V G F+ ++KP + SSTF YR Sbjct: 98 RLVSTKSSGFRKVDGSFARKVVDKPVKAVSSTFARYR 134 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+GF FV + DAE+A M+ + LD + V AR Sbjct: 74 SKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPAR 111 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGR 334 V R G+AF+ F + RDA +A+ +DG+ Sbjct: 33 VARRPPGYAFLDFEDSRDARDAIREVDGK 61 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMAR 373 S+G FV F +A L+ M+G+M+ + L V +A+ Sbjct: 367 SKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVALAQ 404 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L + T E LR+ FE+ GE+ + + D+ TG+ Sbjct: 28 VGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGR 63 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELR 358 RG +V F R DAE+A MDG +D + ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDXRELR 358 RG +V F R DAE+A MDG +D + ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQ 364 RESRGF F+ DA + ++D +L R + V+ Sbjct: 83 RESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVE 119 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L + +++ T E LR F G+V + I RDR TG+ Sbjct: 8 LFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGR 45 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L + +++ T E LR F G+V + I RDR TG+ Sbjct: 8 LFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGR 45 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L + +++ T E LR F G+V + I RDR TG+ Sbjct: 8 LFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGR 45 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+G+ FV++ + + A A+ M+G + R L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMA 370 S+G+ FV++ + + A A+ M+G + R L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 129 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 +D + V L TT + + F + GE+ D I +DR TG+ Sbjct: 38 VDSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQ 81 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXR 349 R SRGFAFV +DAE + ++ +L+ R Sbjct: 110 RVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 141 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDXR 349 R SRGFAFV +DAE + ++ +L+ R Sbjct: 109 RVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 140 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVE 266 V L + TT E L VFE GE+ + + D+ TGK + Sbjct: 108 VYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAK 145 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 +++GF FV F R+ A+EAL R+L+ R Q+A G Sbjct: 143 KAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLASMG 182 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVE 266 V L + TT E L VFE GE+ + + D+ TGK + Sbjct: 108 VYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAK 145 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 +++GF FV F R+ A+EAL R+L+ R Q+A G Sbjct: 143 KAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLASMG 182 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 240 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 273 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 238 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRV 361 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 238 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L + +++ T+ + LR F GEV + I +DR TG+ Sbjct: 8 LFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGR 45 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L + +++ T+ + LR F GEV + I +DR TG+ Sbjct: 8 LFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGR 45 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 L V NL + + LR++FE G V + +P D TG+ Sbjct: 267 LYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQ 304 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 189 LRRVFERCGEVGDIYIPRD 245 L + F CGE+ IY+PRD Sbjct: 44 LTKHFASCGEITQIYVPRD 62 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 242 RSVHRESRGFAFVRFFERRDAEEALDTMDG 331 R +R+SRG FV++ + A A+D ++G Sbjct: 2 RDEYRQSRGCGFVKYSSKETAMAAIDGLNG 31 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 239 +L V N+ T+ E L+ +F+R GEV I P Sbjct: 293 ALYVKNIPENTSTEQLKELFQRHGEVTKIVTP 324 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVE 266 V L + TT E+L+ FE GE+ + + D+ TG+ + Sbjct: 167 VRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAK 204 >At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identical to receptor kinase (CLV1) GB:AAB58929 GI:2160756 [Arabidopsis thaliana] Length = 980 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +3 Query: 111 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVEDS 272 G PP + G+VSLK +L+ ++ + F G + I + R+ G++ ++ Sbjct: 279 GHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEA 332 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 V L + T E LRR F++ G++ + + D+ TG+ Sbjct: 28 VGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGR 63 >At1g07600.1 68414.m00813 metallothionein-like protein 1A (MT-1A) (MT-Q) (MT-2) identical to Metallothionein-like protein 1A (MT-1A) (MT-Q) (MT-2) SP:P43392 from (Arabidopsis thaliana) Length = 45 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = -2 Query: 497 SESDCGNG----CGYDCASNYDGGNETWTCACDRNDSC 396 ++S+CG G CG C+ + E C+C N SC Sbjct: 2 ADSNCGCGSSCKCGDSCSCEKNYNKECDNCSCGSNCSC 39 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELR 358 S+G+ FVRF + + A+ M+G+ R +R Sbjct: 214 SKGYGFVRFADESEQIRAMTEMNGQYCSSRPMR 246 >At4g19670.1 68417.m02889 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain PF01485: IBR domain Length = 532 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 485 CGNGCGYDCASNYDGGNETWTCA 417 CG+ Y C + Y G +T TCA Sbjct: 398 CGHEFCYSCGAEYREGQQTCTCA 420 >At3g53830.1 68416.m05947 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GIi;10177674) [Arabidopsis thaliana] Length = 487 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 485 CGNGCGYDCASNYDGGNETWTCACDRNDSCMAMRGDH 375 CG GCG+ A + G TW D S +A G H Sbjct: 57 CGGGCGFAMAISEKGKLITWGSTDDEGQSYVA-SGKH 92 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDXRELRVQMARYG 379 SRGF FV + A A+ M + LD R + V A G Sbjct: 76 SRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSG 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,077,807 Number of Sequences: 28952 Number of extensions: 233032 Number of successful extensions: 898 Number of sequences better than 10.0: 150 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -