BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0079 (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0429 - 3132848-3135043 28 7.3 02_01_0425 - 3102629-3104692,3106505-3108546,3109918-3109989,311... 28 7.3 >02_01_0429 - 3132848-3135043 Length = 731 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 228 PGFICQMTLSDII*TKNNAHRADVVLNLNKNTYLGYFNIF 109 P IC +T ++ NN + L LNK +L FN++ Sbjct: 596 PQAICNLTKLVMLDLSNNNLTGTIPLELNKLNFLSAFNVY 635 >02_01_0425 - 3102629-3104692,3106505-3108546,3109918-3109989, 3110157-3111444 Length = 1821 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 228 PGFICQMTLSDII*TKNNAHRADVVLNLNKNTYLGYFNIF 109 P IC +T ++ NN + L LNK +L FN++ Sbjct: 1019 PQAICNLTKLVMLDLSNNNLTGTIPLELNKLNFLSAFNVY 1058 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,071,526 Number of Sequences: 37544 Number of extensions: 281291 Number of successful extensions: 471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -