BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0073 (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.9 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 3.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 3.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 3.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.0 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.0 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.0 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 22 6.6 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 270 NGDNLIMKHEIT-LTEALCGFEFVAKHLDGRDLLIR 374 + D++++ E + TEA+ EF+A+HL DL I+ Sbjct: 434 SSDSVLLSPEASKATEAV---EFIAEHLRNEDLYIQ 466 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 167 LSLIPFSMCTSKIFVSFKTFFPLHLEHLSFS 75 LSL+ F + SKI PL ++L F+ Sbjct: 273 LSLVVFLLLVSKILPPTSLVLPLIAKYLLFT 303 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 430 PSPCTHLTSPG 398 P+PCTH T+ G Sbjct: 432 PNPCTHTTTNG 442 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 430 PSPCTHLTSPG 398 P+PCTH T+ G Sbjct: 418 PNPCTHTTTNG 428 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 430 PSPCTHLTSPG 398 P+PCTH T+ G Sbjct: 452 PNPCTHTTTNG 462 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 430 PSPCTHLTSPG 398 P+PCTH T+ G Sbjct: 401 PNPCTHTTTNG 411 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 352 SKCLATNSKPHNASVSVISCFI 287 +KC ATN + + +SC + Sbjct: 563 TKCKATNEETYRGGKGALSCLL 584 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 352 SKCLATNSKPHNASVSVISCFI 287 +KC ATN + + +SC + Sbjct: 563 TKCKATNEETYRGGKGALSCLL 584 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 352 SKCLATNSKPHNASVSVISCFI 287 +KC ATN + + +SC + Sbjct: 563 TKCKATNEETYRGGKGALSCLL 584 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 338 NKFKTTQCFSKCD 300 NKFKTT+ S C+ Sbjct: 25 NKFKTTRYLSVCE 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,947 Number of Sequences: 438 Number of extensions: 3453 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -