BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0070 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 3.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.2 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.6 bits (46), Expect = 3.5 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +2 Query: 74 TPHCLQKFSKLALKNLALQSPEKSTRCMKRLVCSRHLEVSMSTLFFLMFRQG--CSHLSL 247 TP + + +N ++ S E R +K +C R S+S + L+ +G C +++ Sbjct: 114 TPEVENRIEQYKRENPSIFSWEIRDRLVKEGICDRSTAPSVSAISRLLRGKGGECDEITI 173 Query: 248 E 250 + Sbjct: 174 Q 174 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 343 VMELPSTSSQNAESLAFLVVLTHL 272 +ME+ + +N + + +VVLTHL Sbjct: 436 LMEMWNIPRENIDPIPLVVVLTHL 459 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 562 SWRNSEEGPHRFA 600 +WR + GPHR A Sbjct: 597 TWRRNFHGPHRLA 609 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 562 SWRNSEEGPHRFA 600 +WR + GPHR A Sbjct: 489 TWRRNFHGPHRLA 501 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/40 (22%), Positives = 18/40 (45%) Frame = -3 Query: 421 PGSTACSGSTRINIPSGKLGLEPVGAVMELPSTSSQNAES 302 P C G++ +N+ +P + + +T+S N S Sbjct: 1323 PEKATCDGTSNVNVVDIVTTAKPAQSTTSVSTTTSWNPGS 1362 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,687 Number of Sequences: 336 Number of extensions: 4110 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -