BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0070 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 8e-26 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 112 3e-25 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 112 3e-25 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 112 3e-25 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 78 9e-15 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 77 1e-14 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 77 1e-14 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 77 1e-14 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 77 1e-14 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 77 1e-14 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 77 1e-14 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 77 1e-14 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 77 1e-14 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 77 1e-14 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 77 2e-14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 77 2e-14 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 77 2e-14 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 77 2e-14 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 77 2e-14 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 77 2e-14 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 77 2e-14 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 77 2e-14 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 77 2e-14 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 77 2e-14 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 77 2e-14 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 77 2e-14 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 77 2e-14 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 77 2e-14 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 77 2e-14 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 77 2e-14 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 77 2e-14 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 77 2e-14 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 77 2e-14 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 77 2e-14 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 77 2e-14 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 77 2e-14 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 77 2e-14 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 77 2e-14 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 77 2e-14 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 77 2e-14 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 77 2e-14 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 77 2e-14 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 77 2e-14 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 77 2e-14 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 77 2e-14 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 77 2e-14 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 77 2e-14 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 77 2e-14 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 77 2e-14 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 77 2e-14 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 77 2e-14 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 74 1e-13 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 73 3e-13 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 73 3e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 73 3e-13 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 73 3e-13 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 73 3e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 72 4e-13 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 72 4e-13 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 72 4e-13 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 72 4e-13 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 72 4e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 72 4e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 72 4e-13 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 72 4e-13 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 72 4e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 72 4e-13 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 72 4e-13 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 72 4e-13 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 72 4e-13 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 72 4e-13 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 72 4e-13 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 72 4e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 72 4e-13 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 72 4e-13 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 72 4e-13 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 72 4e-13 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 72 4e-13 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 72 4e-13 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 72 4e-13 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 72 4e-13 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 72 4e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 72 4e-13 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 72 4e-13 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 72 4e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 72 4e-13 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 72 4e-13 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 72 4e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 72 4e-13 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 72 4e-13 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 72 4e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 72 4e-13 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 72 4e-13 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 72 4e-13 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 72 4e-13 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 72 4e-13 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 72 4e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 72 4e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 72 4e-13 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 72 4e-13 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 72 4e-13 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 72 4e-13 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 72 4e-13 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 72 4e-13 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 72 4e-13 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 72 4e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 72 4e-13 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 72 4e-13 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 72 4e-13 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 72 4e-13 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 72 4e-13 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 72 4e-13 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 72 4e-13 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 114 bits (274), Expect = 8e-26 Identities = 53/61 (86%), Positives = 55/61 (90%), Gaps = 1/61 (1%) Frame = -2 Query: 623 KLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPVNCNTTHYRAN 447 +LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGF SHDVVKRRPVNCNTTHYRAN Sbjct: 22 QLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRAN 79 Query: 446 W 444 W Sbjct: 80 W 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 112 bits (270), Expect = 3e-25 Identities = 54/66 (81%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPVNCNTT 462 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTT Sbjct: 588 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTT 642 Query: 461 HYRANW 444 HYRANW Sbjct: 643 HYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 112 bits (270), Expect = 3e-25 Identities = 54/66 (81%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPVNCNTT 462 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTT Sbjct: 31 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTT 85 Query: 461 HYRANW 444 HYRANW Sbjct: 86 HYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 112 bits (270), Expect = 3e-25 Identities = 54/66 (81%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPVNCNTT 462 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTT Sbjct: 31 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTT 85 Query: 461 HYRANW 444 HYRANW Sbjct: 86 HYRANW 91 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 83.4 bits (197), Expect = 2e-16 Identities = 43/54 (79%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSW GF SHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 81.8 bits (193), Expect = 5e-16 Identities = 42/54 (77%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = +1 Query: 478 TGRRFTTS*LENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 TGRRFT ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 91 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 78.2 bits (184), Expect = 7e-15 Identities = 46/71 (64%), Positives = 50/71 (70%), Gaps = 1/71 (1%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPVNCNTT 462 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS RR C TT Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKTT 53 Query: 461 HYRANWVPGPP 429 A+ PG P Sbjct: 54 ---ASEFPGDP 61 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 95 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 136 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/59 (38%), Positives = 28/59 (47%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL*YDSL*GELGTGPPR 427 +G SVRA + + G + + QSRRCKTTASE D L L PPR Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL--VLERPPPR 70 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 125 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 77.8 bits (183), Expect = 9e-15 Identities = 40/53 (75%), Positives = 41/53 (77%) Frame = -1 Query: 636 PFAIQAAXLLGKGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 PFAIQAA LLG+ LFAITPAGERGMCCKAIKLGNARVF KTTAS Sbjct: 11 PFAIQAAQLLGRAIGA-GLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 45 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 215 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 257 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 226 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 370 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 412 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 381 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 286 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 328 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 297 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 178 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 220 Score = 68.9 bits (161), Expect = 4e-12 Identities = 35/44 (79%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 EN GVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 525 ENTGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 566 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRP 555 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTA 481 +G SVRA + + G + + QSRRCKTTA Sbjct: 189 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 45 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 45 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 45 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 26 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 68 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 37 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 31 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 73 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 260 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 302 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 271 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 444 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 486 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 455 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 279 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 321 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 290 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 129 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 171 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 140 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 45 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 3 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 45 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 580 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 622 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 591 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 494 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 536 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 505 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 638 AHSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 178 SHSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 220 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 +G SVRA + + G + + QSRRCKTTASEL Sbjct: 189 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 472 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 513 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 482 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 77.0 bits (181), Expect = 2e-14 Identities = 40/54 (74%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 478 TGRRFTTS*LENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 TGRR ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 66 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 65 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 106 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 75 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 646 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 687 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 656 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 555 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 596 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 565 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 77.0 bits (181), Expect = 2e-14 Identities = 40/54 (74%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 478 TGRRFTTS*LENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 TGRR ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 86 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 77.0 bits (181), Expect = 2e-14 Identities = 40/54 (74%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 478 TGRRFTTS*LENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 TGRR ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 76 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 77.0 bits (181), Expect = 2e-14 Identities = 40/54 (74%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 478 TGRRFTTS*LENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 TGRR ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 96 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 77.0 bits (181), Expect = 2e-14 Identities = 40/54 (74%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 478 TGRRFTTS*LENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 TGRR ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 123 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 11 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 52 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 21 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 188 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 229 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 198 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 914 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 955 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 924 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 262 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 303 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 272 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 59.7 bits (138), Expect = 3e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 634 IRHSSCXTVGEGRIGAGPLRYYASWRKGDVLQGD 533 IRHS C TVG+G GPLRYYASWRKGDVLQGD Sbjct: 86 IRHSGCATVGKGD-RCGPLRYYASWRKGDVLQGD 118 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 68 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 109 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 78 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/44 (84%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 19 HSPFRLRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 77.0 bits (181), Expect = 2e-14 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPVNCNTTHYRANW 444 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV + H + Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV--PSLHACRST 57 Query: 443 VPGPPEI 423 + PPEI Sbjct: 58 LEDPPEI 64 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/49 (77%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/49 (77%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/49 (77%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 73.7 bits (173), Expect = 1e-13 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW--ANCKR*YFVKIR 672 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW C + Y ++R Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWRLMRCGQNYTTRLR 118 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 93 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/49 (77%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/49 (77%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/49 (77%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 620 LRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFSSHDVVKRRPV 477 LRNCW GR+ R SSLLRQLAKGGCAARRLSWVTPGFS KRRPV Sbjct: 2 LRNCWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 72.9 bits (171), Expect = 3e-13 Identities = 37/49 (75%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEWANCKR 651 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW +R Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWRLMRR 156 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 140 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 72.9 bits (171), Expect = 3e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 638 AHSPFKLRNCWGRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 +HSPF+LRNC G SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 44 SHSPFRLRNC-GEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 86 Score = 36.3 bits (80), Expect = 0.027 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = -1 Query: 606 GKGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTASEL 472 G+G SVRA + + G + + QSRRCKTTASEL Sbjct: 54 GEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 72.9 bits (171), Expect = 3e-13 Identities = 41/72 (56%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEWANCKR*YFVKIRVKFL 684 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW + YF+ + Sbjct: 662 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWRLMR--YFLLTHLSRS 717 Query: 685 LNQLIFNQLGRN 720 + L+ G N Sbjct: 718 SDDLLDIDFGHN 729 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 692 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 72.9 bits (171), Expect = 3e-13 Identities = 40/72 (55%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEWANCKR*YFVKIRVKFL 684 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW + YF+ + L Sbjct: 447 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWRLMR--YFLLTHLCVL 502 Query: 685 LNQLIFNQLGRN 720 + ++ + N Sbjct: 503 MTAVMIPLIASN 514 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 477 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 72.5 bits (170), Expect = 3e-13 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -2 Query: 635 HSPFKLRNCW-GRANRCGPSSLLRQLAKGGCAARRLSWVTPGFS 507 HSPF+LRN W GR+ R SSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 65 HSPFRLRNYWEGRSVRA--SSLLRQLAKGGCAARRLSWVTPGFS 106 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 603 KGESVRALFAITPAGERGMCCKAIKLGNARVFQSRRCKTTAS 478 +G SVRA + + G + + QSRRCKTTAS Sbjct: 75 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 72.5 bits (170), Expect = 3e-13 Identities = 37/55 (67%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEWANCKR*YFVKI 669 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW + Y + + Sbjct: 539 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWRLMRARYTITL 591 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 569 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 86 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 75 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 113 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 95 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 84 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 87 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 113 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 118 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 107 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 89 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 78 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 109 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 121 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 110 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 97 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 86 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 86 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 75 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 76 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 65 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 101 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 90 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 110 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 99 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 104 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 93 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 120 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 108 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 91 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 80 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 226 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 267 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 256 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 121 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 162 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 151 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 100 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 89 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 79 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 68 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 67 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 98 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 87 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 391 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 432 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 421 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 117 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 158 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 147 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 134 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 123 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 90 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 18 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 59 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 69 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 58 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 89 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 78 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 113 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 154 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 143 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 96 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 85 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 350 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 391 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 380 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 90 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 131 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 120 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 101 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 90 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 67 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 110 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 99 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 94 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 83 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 144 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 185 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 174 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 114 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 103 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 90 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 153 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 194 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 183 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 843 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 884 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 873 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 67 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 111 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 100 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 85 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 124 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 113 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 107 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 96 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 120 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 116 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQR DW+ + L L P + ++ ARTD P Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 105 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 266 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 307 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 296 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 124 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 165 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 154 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 101 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 90 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 87 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 88 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 111 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 152 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 141 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 124 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 165 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 154 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 90 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 71 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 109 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 88 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 85 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 21 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 62 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 51 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 29 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 70 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 59 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 406 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 447 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 436 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 96 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 85 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 105 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 94 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 87 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 129 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 170 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 159 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 106 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 95 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 116 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 105 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 78 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 119 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 108 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 424 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 465 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 454 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 121 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 162 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 151 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 118 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 107 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 107 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 96 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 97 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 86 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 171 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 212 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 201 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 116 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 105 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 62 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 103 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 92 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 139 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 128 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 88 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 114 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 103 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 52 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 93 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 82 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 195 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 236 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 225 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 85 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 91 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 80 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 105 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 94 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 61 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 102 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 91 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 85 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 86 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 75 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 100 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 89 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 90 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 142 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 183 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 172 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 92 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 81 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 135 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 124 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 73 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 62 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 163 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 204 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 193 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 350 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 391 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 380 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 108 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 72 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 61 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 98 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 L VVLQRRDW+ + L L P + ++ ARTD P Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 87 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 119 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 160 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 149 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 80 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 96 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 137 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 126 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 87 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 111 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 100 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 304 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 345 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 334 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 108 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 109 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 36/44 (81%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 508 ENPGVTQLNRLAAHPPFASWRNSEEGPHRFALP-QQXRSLNGEW 636 ENPGVTQLNRLAAHPPFASWRNSEE R P QQ RSLNGEW Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 67 Score = 32.3 bits (70), Expect = 0.44 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 479 LAVVLQRRDWKTLALPNLIALQHIPLSPAGVIAKRARTDSP 601 LAVVLQRRDW+ + L L P + ++ ARTD P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,654,496 Number of Sequences: 59808 Number of extensions: 510983 Number of successful extensions: 11669 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8006 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -