BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0070 (765 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC131544-1|AAI31545.1| 504|Homo sapiens docking protein 7 protein. 30 7.9 BC043568-1|AAH43568.1| 306|Homo sapiens DOK7 protein protein. 30 7.9 AK075037-1|BAC11367.1| 298|Homo sapiens protein ( Homo sapiens ... 30 7.9 >BC131544-1|AAI31545.1| 504|Homo sapiens docking protein 7 protein. Length = 504 Score = 30.3 bits (65), Expect = 7.9 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -3 Query: 430 QKSPGSTAC---SGSTRINIPSGKLGLEPVGAVMELPSTS 320 Q SPG++A G T PSG LG G VME P S Sbjct: 423 QGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQDS 462 >BC043568-1|AAH43568.1| 306|Homo sapiens DOK7 protein protein. Length = 306 Score = 30.3 bits (65), Expect = 7.9 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -3 Query: 430 QKSPGSTAC---SGSTRINIPSGKLGLEPVGAVMELPSTS 320 Q SPG++A G T PSG LG G VME P S Sbjct: 225 QGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQDS 264 >AK075037-1|BAC11367.1| 298|Homo sapiens protein ( Homo sapiens cDNA FLJ90556 fis, clone OVARC1000956, weakly similar to SKIN SECRETORY PROTEIN XP2 PRECURSOR. ). Length = 298 Score = 30.3 bits (65), Expect = 7.9 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -3 Query: 430 QKSPGSTAC---SGSTRINIPSGKLGLEPVGAVMELPSTS 320 Q SPG++A G T PSG LG G VME P S Sbjct: 113 QGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQDS 152 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,190,904 Number of Sequences: 237096 Number of extensions: 2774692 Number of successful extensions: 9865 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9864 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -