BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0070 (765 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001899-1|AAN71688.1| 773|Drosophila melanogaster SD20577p pro... 29 9.2 AE014298-3060|AAF50875.1| 223|Drosophila melanogaster CG11229-P... 29 9.2 AE014297-2554|AAF55575.2| 1784|Drosophila melanogaster CG31224-P... 29 9.2 >BT001899-1|AAN71688.1| 773|Drosophila melanogaster SD20577p protein. Length = 773 Score = 28.7 bits (61), Expect = 9.2 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 77 PHCLQKFSKLALKNLALQSPEKSTRCMKRLVCSR-HLEVSMSTL 205 PHC F KL +N + R +RL+C++ + SM TL Sbjct: 262 PHCEAIFEKLKERNAHMIGEHNYVRQNRRLICTQPQINTSMLTL 305 >AE014298-3060|AAF50875.1| 223|Drosophila melanogaster CG11229-PA protein. Length = 223 Score = 28.7 bits (61), Expect = 9.2 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 542 ARRLSWVTPGFSSHD-VVKRRPVNCNTTHYRANWVPGPP 429 A R SW SH ++ VN + T R+ W PGPP Sbjct: 170 AGRCSWSPSALWSHILIIFSIVVNASATASRSFWFPGPP 208 >AE014297-2554|AAF55575.2| 1784|Drosophila melanogaster CG31224-PA protein. Length = 1784 Score = 28.7 bits (61), Expect = 9.2 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 77 PHCLQKFSKLALKNLALQSPEKSTRCMKRLVCSR-HLEVSMSTL 205 PHC F KL +N + R +RL+C++ + SM TL Sbjct: 1273 PHCEAIFEKLKERNAHMIGEHNYVRQNRRLICTQPQINTSMLTL 1316 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,434,849 Number of Sequences: 53049 Number of extensions: 745942 Number of successful extensions: 1801 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1801 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3520086471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -