BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0068 (518 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK092303-1|BAC03856.1| 316|Homo sapiens protein ( Homo sapiens ... 32 1.0 AK131382-1|BAD18533.1| 165|Homo sapiens protein ( Homo sapiens ... 30 4.2 >AK092303-1|BAC03856.1| 316|Homo sapiens protein ( Homo sapiens cDNA FLJ34984 fis, clone OCBBF2001639. ). Length = 316 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 207 EPISEPLWTTVKTNKARPQHRPSYI---L*SPCGPRRTRPLSATASFP 341 EP+ EP + +++ +RP+ RP L S GPR RP +FP Sbjct: 79 EPVCEPEFRSMRMEVSRPEPRPDGTGPGLGSQAGPRTPRPAPPPLAFP 126 >AK131382-1|BAD18533.1| 165|Homo sapiens protein ( Homo sapiens cDNA FLJ16455 fis, clone BRAWH3007441, moderately similar to Homo sapiens CAT56 protein (CAT56). ). Length = 165 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 181 LPLSYFPSLNQFQSPCGPRSKQIRPGHSIVLPTSFRAPVDHGVRDRSAP 327 L LS FP+L++ P G R I P S+ P R P+ G+ RS+P Sbjct: 27 LSLSLFPALHR--GPPGSRGPLIPPLLSLPPPPWGRGPIRRGLGPRSSP 73 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,777,417 Number of Sequences: 237096 Number of extensions: 1822041 Number of successful extensions: 3284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3284 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -