BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0066 (769 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0009 - 13657511-13657578,13658060-13658276,13658363-13658509 30 2.3 10_08_0457 + 18076911-18077272,18077356-18077475,18077554-180777... 28 9.4 >09_04_0009 - 13657511-13657578,13658060-13658276,13658363-13658509 Length = 143 Score = 29.9 bits (64), Expect = 2.3 Identities = 25/62 (40%), Positives = 30/62 (48%) Frame = -1 Query: 439 LAAANIRQGALAVVLPAVPGIEAVTFVNFLSAFRCLSDVVSQEVGALNVAVFAWTGTFAA 260 LAA + A V++ A AV V L+A L V VGAL+VAVF T AA Sbjct: 55 LAALTVLLVAAFVLVAAATSAAAVAAVVSLAALSALLAVAY--VGALSVAVFVVAATTAA 112 Query: 259 PV 254 V Sbjct: 113 TV 114 >10_08_0457 + 18076911-18077272,18077356-18077475,18077554-18077782, 18077993-18078652,18079224-18079425,18079521-18079611, 18079780-18079837 Length = 573 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 221 EGLRIVPDQRPDWCSKGASPGKD 289 E L I+ D PDW SK PG D Sbjct: 529 EQLHILEDLSPDWISKKVIPGGD 551 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,236,138 Number of Sequences: 37544 Number of extensions: 338586 Number of successful extensions: 773 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -