BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0065 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.0 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -1 Query: 393 VDRSNTTLALCTGPNCEKYSRSCRWPTVQAR 301 V NT CT + EKY C V+ + Sbjct: 182 VSMENTENKSCTDSDIEKYKMFCNLENVKLK 212 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +3 Query: 423 NLLVPQLQLMQLISRFTHLKVST*VFNCK*LDIL 524 NL +P+ L + + + + K +T ++C +D+L Sbjct: 203 NLHLPRFTLEKFFTDYCNSKTNTGEYSCLKVDLL 236 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +3 Query: 423 NLLVPQLQLMQLISRFTHLKVST*VFNCK*LDIL 524 NL +P+ L + + + + K +T ++C +D+L Sbjct: 203 NLHLPRFTLEKFFTDYCNSKTNTGEYSCLKVDLL 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,192 Number of Sequences: 438 Number of extensions: 3489 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -