BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0063 (791 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) 33 0.35 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_48915| Best HMM Match : Pep_M12B_propep (HMM E-Value=0.0031) 31 0.81 SB_18969| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-38) 31 1.1 SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 31 1.4 SB_18180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_46085| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_20222| Best HMM Match : SSF (HMM E-Value=0.0045) 30 2.5 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 29 3.3 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 29 3.3 SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) 29 4.3 SB_39435| Best HMM Match : 7tm_1 (HMM E-Value=4.60004e-41) 29 5.7 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_43337| Best HMM Match : RNA_pol_delta (HMM E-Value=8.5) 28 7.5 SB_37366| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.82) 28 7.5 SB_49954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_24925| Best HMM Match : Glyco_hydro_35 (HMM E-Value=0) 28 10.0 SB_17637| Best HMM Match : Ferritin (HMM E-Value=3.4) 28 10.0 SB_17638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 >SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 42.7 bits (96), Expect = 3e-04 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 6/89 (6%) Frame = +3 Query: 279 LFLKSNVDLGGLAQIIISQNYIGSVVK------QCLXXXXXXXXXXXXXXXXVFGVTTVV 440 LFLK+ V+L LA +II+Q+ IGS++K Q ++G+ +V+ Sbjct: 474 LFLKNTVNLSELADLIIAQDKIGSIIKVVDDEEQAEDSNNPSAEEEGEYEEEIYGLVSVL 533 Query: 441 NITKRKNEPSVAQIRELLTKLSQRMQIPE 527 ++ + K + V QI++LL + + PE Sbjct: 534 DLAQHKEKQCVKQIKDLLLEKCKACSKPE 562 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = +2 Query: 521 PRTKELIKYILADDSQHTGLVINERILNIPAAISVPLFASLQTELEKAHREKYAIQL*IP 700 P + IL++ S GL+I+ER +NIP I+ PL+ +L EL++ ++++ P Sbjct: 561 PEALSSFQNILSNKS--VGLLISERFINIPPQIAPPLYRTLGNELKEQNKKQSTFSFSYP 618 Query: 701 L 703 + Sbjct: 619 V 619 >SB_34750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSDFQVL 261 + DS S+ DSD DSD + + + +D + + DSD +V+ Sbjct: 90 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSEVI 130 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 12 DNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 48 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 14 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 50 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 16 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 52 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 18 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 54 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 20 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 56 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 22 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 58 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 24 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 60 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 26 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 62 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 28 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 64 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 30 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 66 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 32 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 68 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 34 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 70 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 36 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 72 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 38 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 74 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 40 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 76 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 42 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 78 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 44 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 80 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 46 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 82 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 48 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 84 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 50 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 86 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 52 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 88 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 54 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 90 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 56 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 92 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 58 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 94 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 60 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 96 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 62 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 98 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 64 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 100 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 66 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 102 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 68 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 104 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 70 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 106 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 72 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 108 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 74 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 110 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 76 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 112 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 78 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 114 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 80 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 116 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 82 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 118 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 84 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 120 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 86 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 122 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ DSD DSD + + + +D + + DSD Sbjct: 88 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 124 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + D+ S+ DSD DSD + + + +D + + DSD Sbjct: 10 DNDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 46 >SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) Length = 661 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + D + D D D DGN GE E D +G + +D D Sbjct: 612 DDDDDGDDDGDEDDDGNDDGEDEDDGDDDGEDEDDGD 648 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + D G + D D D DG+ G+++ + +G + +D D Sbjct: 602 DDDDGDDGDGDDDDDGDDDGDEDDDGNDDGEDEDDGD 638 >SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 31.5 bits (68), Expect = 0.81 Identities = 25/78 (32%), Positives = 34/78 (43%) Frame = +1 Query: 94 IKRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSDFQVLSSY* 273 IK RK + K+QDSG E S + V K+ ++ F NP D VL + Sbjct: 567 IKSLRKENVSIATMKDQDSGLEVSS--SKEKAEVLSKQFESVFTQENPNLPDLSVLPRW- 623 Query: 274 GNCF*NQMLTLEG*PKLL 327 C N ++ G KLL Sbjct: 624 -PCMSNLQFSVNGIEKLL 640 >SB_48915| Best HMM Match : Pep_M12B_propep (HMM E-Value=0.0031) Length = 511 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DSGS+ D D D DG+ G+ + D +G D D Sbjct: 199 DSDSGSDSDGDGDGDGDGDGDGDGDGDGDGDGDGDGD 235 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 106 RKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 ++ TQ + DS S DSD D DG+ G+ + D +G D D Sbjct: 186 KRATQCDDVDGDGDSDSGSDSDGDGDGDGDGDGDGDGDGDGDGDGDGD 233 >SB_18969| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-38) Length = 488 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = -2 Query: 328 IIIWASPPRSTFDFRNSCLSSCLIPGSHYLLGYVLRNQPVAL 203 ++++ASPP T + + L + +IP + L +VLR +P L Sbjct: 141 LVVFASPPSRTAPYLQAILGNFIIPLTIVLRVFVLRKKPTIL 182 >SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + D G E+D+D D D +Y E+++ D +G ED+D Sbjct: 83 DDDDGYEEDNDCDDD-DYDYEEDIDGDDDGDYEEDND 118 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +1 Query: 97 KRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 ++ +K + K K+ D+ ++ D+D D+D + + + D + N D+D Sbjct: 3123 EKQKKKKKKKKEEKKNDNNNDNDNDNDNDNDNDNDNDNDNDIDNDNDNDND 3173 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +1 Query: 97 KRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 K+ +K + K D+ ++ D+D D+D + + ++ D + N D+D Sbjct: 3127 KKKKKKKEEKKNDNNNDNDNDNDNDNDNDNDNDNDNDIDNDNDNDNDNDND 3177 >SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) Length = 831 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/72 (27%), Positives = 37/72 (51%) Frame = +1 Query: 115 TQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSDFQVLSSY*GNCF*NQ 294 T T+K+ K +S E+DSD D D +Y G+ +++ E + + F+ L G+ + Sbjct: 679 TMTSKSDKTSESNKEEDSDDDDDDDY-GDDSDKSN-EAKVLDRDGFEALECVKGDQYLTD 736 Query: 295 MLTLEG*PKLLY 330 M +G +L+ Sbjct: 737 MGNTKGHTAMLH 748 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 103 TRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKEL 210 T K +T+++ KE+DS + D D+ D + E ++ Sbjct: 681 TSKSDKTSESNKEEDSDDDDDDDYGDDSDKSNEAKV 716 >SB_18180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 94 IKRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 IKR +K+ Q + D+ + D+D D+DG + G+ + D +G D D Sbjct: 105 IKR-KKVKQQRIKKYDDDADDDADADADADGYFDGDGDGDGDGDGDGDGDGD 155 >SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 136 KEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 +E+D G E SD DSD + + + +D N +D D Sbjct: 924 RERDEGGEGYSDSDSDSDSDSDSDSDSDSHHNNDDDDD 961 >SB_46085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 103 TRKLTQTAKATKEQDSGS-EKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 T +T T + D G + D D D DG+ G+ + D +G + DSD Sbjct: 12 TMTMTMTMTIDDDDDDGDGDGDGDGDGDGDGDGDGDGDGDGDGDSDSDSD 61 >SB_20222| Best HMM Match : SSF (HMM E-Value=0.0045) Length = 471 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 684 IAYFSL*AFSSSVCSDANNGTLIAAGMFS 598 IA+F L A S++V S A++ L AA MFS Sbjct: 308 IAFFGLGAVSAAVMSSADSSVLSAASMFS 336 >SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) Length = 508 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS ++ DSD D DG+Y + + D +G +D + Sbjct: 417 DSDSDNDDDSDGDGDGDYDSDGDGDYDSDGDGDDDDN 453 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 145 DSGSEKDSDFDSDG----NYVGEKELQADFEGRNPEDSDFQ 255 D SE D D D DG E+E D E N ED D Q Sbjct: 116 DCDSEDDGDDDDDGLLGEEEKNERESDEDVESNNNEDEDIQ 156 >SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 127 KATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPED 243 KA+K + EKD++ D+D K+ A EG++PED Sbjct: 456 KASKRESRSVEKDNEGDADA-----KDEDAKLEGKSPED 489 >SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) Length = 309 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 127 KATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 K + D +E D+D DSD + + + +D E N DSD Sbjct: 12 KNDNDNDIVNENDNDNDSDSDNENDDDNDSDNENDNDSDSD 52 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + DS S+ ++D D+D + + + +D E N DSD Sbjct: 26 DNDSDSDNENDDDNDSDNENDNDSDSDNENDNVNDSD 62 >SB_39435| Best HMM Match : 7tm_1 (HMM E-Value=4.60004e-41) Length = 352 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -1 Query: 248 SLSSGLRPSKSACSSFSPT*LPSESKSESFSLPESCSFVAFAVCV 114 S+ GL +KS CS PT ESK + L S + +AF +CV Sbjct: 202 SILKGLFITKSICSETVPTDTNRESKKKLAKLLASVT-IAFYICV 245 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 109 KLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFE 225 +L Q K+ + G+ D DF+ + Y E+ LQA E Sbjct: 2038 RLLQAEKSERFAGEGASDDEDFEEEEEYYRERYLQASRE 2076 >SB_43337| Best HMM Match : RNA_pol_delta (HMM E-Value=8.5) Length = 121 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + D E D D +SD + G+ + D +G +DSD Sbjct: 81 DSDDDCESDDDGESDNDGDGDDDGDGDDDGEGDDDSD 117 >SB_37366| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.82) Length = 705 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 585 ITRPVC*ESSARIYLINSLVLGSAFSEIVL*AIL*SVP 472 ++ P C ES + Y S++ GSA S +L A+L + P Sbjct: 668 LSDPSCPESEFQTYRFKSVLFGSASSPFMLNAVLQNTP 705 >SB_49954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 139 EQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + D + D D D DG+ GE E D +G D D Sbjct: 9 DDDDDDDDDDDDDDDGDGDGEGEGDGDSDGDGDGDGD 45 >SB_24925| Best HMM Match : Glyco_hydro_35 (HMM E-Value=0) Length = 555 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 553 QNIFN*FFGSGICIL*-DSFVSNSLICATLGSFFLLVIFTTVVTPK 419 +N+F G + + D F + L C TL S F V F V PK Sbjct: 169 ENLFRSHLGKDVVLFTTDGFAKSMLDCGTLPSLFTTVDFGAGVDPK 214 >SB_17637| Best HMM Match : Ferritin (HMM E-Value=3.4) Length = 185 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +1 Query: 118 QTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + +KA E+DS EKD GEKE +D EG P +S+ Sbjct: 140 EESKAQDEEDSTDEKDEG--------GEKEESSDEEGSTPAESN 175 >SB_17638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +1 Query: 118 QTAKATKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 249 + +KA E+DS EKD GEKE +D EG P +S+ Sbjct: 11 EESKAQDEEDSTDEKDEG--------GEKEESSDEEGSTPAESN 46 >SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -1 Query: 188 LPSESKSESFSLPESCSFVAFAVCVNFLVLFIRHFSKINKRGG 60 LP+ S ES S F+A V V LVLF+ + KR G Sbjct: 1970 LPTASARESVPFYRSIWFIAVIVLVAILVLFLLLALCLKKRSG 2012 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,862,824 Number of Sequences: 59808 Number of extensions: 361685 Number of successful extensions: 2228 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2030 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -