BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0061 (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.03c |pom1||DYRK family protein kinase Pom1|Schizosacchar... 26 6.6 SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharo... 25 8.7 SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 25 8.7 SPCC1450.07c |||D-amino acid oxidase |Schizosaccharomyces pombe|... 25 8.7 >SPAC2F7.03c |pom1||DYRK family protein kinase Pom1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1087 Score = 25.8 bits (54), Expect = 6.6 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +2 Query: 344 SDVNTN*SHISHGVVNCSFFGTNLKFFSFITRTTD 448 S +NT+ H + + N FGT+L +++ ++ +D Sbjct: 163 SSLNTSSHHRTSSISNSKSFGTSLSYYNRSSKPSD 197 >SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 572 FLISIITSRPFIFLTKLLLKISYLTSV*KIMNF*LILM*Y*STY 703 F IS++ +T LLLK SYL I + ++LM Y S + Sbjct: 237 FFISLLIGVSIGLITALLLKYSYLRRYPSIESCIILLMAYTSYF 280 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 25.4 bits (53), Expect = 8.7 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 489 TFD-YAFLVTITPSPSVVRVMKLKNFKFVP 403 T+D + FL TITPSPS + N F+P Sbjct: 429 TYDSHTFLTTITPSPS--NSISYTNNTFIP 456 >SPCC1450.07c |||D-amino acid oxidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 348 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 247 HLNYDVTLIVVRGIRHERKRLLHTDE 170 +LNY L++ G+ E+K L H E Sbjct: 148 YLNYMYKLLIEAGVEFEKKELSHIKE 173 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,662,867 Number of Sequences: 5004 Number of extensions: 49808 Number of successful extensions: 109 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -