BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0058 (768 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 30 0.32 SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 26 5.2 SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|... 26 5.2 SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 26 5.2 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 26 6.8 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 30.3 bits (65), Expect = 0.32 Identities = 22/55 (40%), Positives = 27/55 (49%) Frame = +1 Query: 82 MPTEPQSPTPNSKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYETT 246 +PT S TP S TTA+S T PL N +T T A S+ +S NS T Sbjct: 415 LPTSSVSSTPLSSANSTTATSASST--PLSSVNSTTAT-SASSTPLSSVNSTTAT 466 Score = 25.8 bits (54), Expect = 6.8 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 82 MPTEPQSPTPNSKTIFTTASSLPITTMPLKKANRSTRT 195 +PT S TP S TTA+S T PL N +T T Sbjct: 529 LPTSSVSSTPLSSANSTTATSASST--PLTSVNSTTAT 564 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 79 YMPTEPQSPTPNSKTIFTTASSLPITTMP 165 YMP P +P PN+ IF + P+T +P Sbjct: 418 YMPITP-TPYPNNAKIFGYPNQPPLTPIP 445 >SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|Schizosaccharomyces pombe|chr 2|||Manual Length = 1173 Score = 26.2 bits (55), Expect = 5.2 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -3 Query: 499 LVVLPQRNELPADFWTRLVLAIAVGKSAIVVAVIAQRQSKTVALVHQLNVVFGENKCEL 323 L +LP +++PAD ++ + G +VVA S T VH ++ V C+L Sbjct: 733 LSILPIYSQMPADLQAKIFDSAEPGVRKVVVATNIAETSLT---VHGISYVVDTGYCKL 788 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 26.2 bits (55), Expect = 5.2 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 102 SDSKLEDDLYNSILVADYDNAVEKSKQIYED--KKSEVITNVVNKLIRN--NKMNAWSTP 269 ++ KL L N+I++ SK++ E KKS+ + N VNK+ +N N +A Sbjct: 139 NNGKLRTLLQNAIVLLGQQTTNVASKKLNEQDGKKSDNLRNGVNKVKQNMRNGASARDQA 198 Query: 270 TSSGCKA 290 G KA Sbjct: 199 REQGSKA 205 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 25.8 bits (54), Expect = 6.8 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 114 LEDDLYNSILVADYDNAVEKSKQIYEDKKSEVITNVVNKLIRNN 245 LE+D + ++ + A+ SK I D+ E+I + NK I +N Sbjct: 1623 LEEDFIHEPVIDVDEFAISSSKDIDADEDLEIIGSSDNKAIDSN 1666 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,913,952 Number of Sequences: 5004 Number of extensions: 55697 Number of successful extensions: 162 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -