BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0056 (787 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D79995-1|BAA11490.2| 1203|Homo sapiens KIAA0173 protein. 32 2.0 BC021707-1|AAH21707.1| 1199|Homo sapiens tubulin tyrosine ligase... 32 2.0 >D79995-1|BAA11490.2| 1203|Homo sapiens KIAA0173 protein. Length = 1203 Score = 32.3 bits (70), Expect = 2.0 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 257 KESWAAAIDLLTNDECRLLLEVEDFFNDDCDLLKNFPS 370 ++ +A+ +D+LT D+ R+L+E+ED F+ + FPS Sbjct: 996 QDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS 1033 >BC021707-1|AAH21707.1| 1199|Homo sapiens tubulin tyrosine ligase-like family, member 4 protein. Length = 1199 Score = 32.3 bits (70), Expect = 2.0 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 257 KESWAAAIDLLTNDECRLLLEVEDFFNDDCDLLKNFPS 370 ++ +A+ +D+LT D+ R+L+E+ED F+ + FPS Sbjct: 992 QDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS 1029 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,619,309 Number of Sequences: 237096 Number of extensions: 2228597 Number of successful extensions: 7547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7546 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -