BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0053 (636 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 29 3.4 At5g42710.1 68418.m05202 hypothetical protein 28 4.5 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 552 LACGSPSVHSDVXFCPSMSALPIIAKQNSPSVGLFT 445 + C S SV + P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g42710.1 68418.m05202 hypothetical protein Length = 807 Score = 28.3 bits (60), Expect = 4.5 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +1 Query: 187 PDSRGSTVSISLPDSARLASALERSGIIPRMVASHHRPL-GRVHEPNVRNCGSSRTEQYY 363 P +G ++ L S LA ALE +G R+ S + +HE R+ G +R+ Q + Sbjct: 75 PYGKGKSME-KLDLSKALAFALENAGKATRVDPSGSASIISFLHEVGRRSLGETRSSQVF 133 Query: 364 YRNDKPS 384 + +PS Sbjct: 134 VQQQQPS 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,413,640 Number of Sequences: 28952 Number of extensions: 267689 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -