BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0050 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.3 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.5 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.5 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 637 TLEKCRSNTNANIVCHET 584 TLEKCR + N+V +E+ Sbjct: 262 TLEKCRPDPPQNLVINES 279 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 253 TSLIMS*SSASVGFCPS 203 TS+++ SS +GFC S Sbjct: 69 TSILLKVSSLLIGFCAS 85 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 439 SEFLSEVGHDVAQLGRGDEAVAVLVEDAEGLAD 341 S+ + + G+DV L + + VAV+ D G D Sbjct: 1565 SKTVIDAGYDVPVLAQNLDWVAVMTYDFHGQWD 1597 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 331 AIRVLHLARHHCQELGKVYR 272 AI+ RH Q+L +VYR Sbjct: 601 AIKTSPKMRHELQKLAQVYR 620 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,842 Number of Sequences: 336 Number of extensions: 2316 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -