BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0050 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 27 0.22 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 2.1 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 4.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 4.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 4.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 4.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 6.3 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.3 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 8.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.3 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 26.6 bits (56), Expect = 0.22 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 510 RHHDDVEVSRRLVCV*KAENLNIHFVS*HTILAFVL 617 +H E VC+ E + +HF + H +A++L Sbjct: 182 QHQSGSEAEAEFVCIATPEAIELHFTTDHPSVAYLL 217 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -3 Query: 451 DLLVSEFLS--EVGHDVAQLGRGDEAVAVLVE 362 DL S+ L E+ HDVA G+G E V++ V+ Sbjct: 163 DLNTSQLLKQVEIPHDVATTGKG-ELVSLTVQ 193 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P Y Sbjct: 368 PPTPFPRFIPPNAYRFRPPLNPRFGPTY 395 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P Y Sbjct: 379 PPTPFPRFIPPNAYRFRPPLNPRFGPTY 406 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P Y Sbjct: 379 PPTPFPRFIPPNAYRFRPPLNPRFGPTY 406 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P Y Sbjct: 368 PPTPFPRFIPPNAYRFRPPLNPRFGPTY 395 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P++ R R L+ RF P + Sbjct: 372 PPTPFPRFIPPNVYRFRPPLNPRFEPTH 399 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P + Sbjct: 149 PSTPFPRFIPPNAYRFRPPLNPRFEPTH 176 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P + Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P + Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P + Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 335 PRYPCPSSCAPSLSRTRESLSCRFRPRY 252 P P P P+ R R L+ RF P + Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 341 FLPRYPCPSSCAP 303 F P Y P++CAP Sbjct: 1803 FSPEYDDPANCAP 1815 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,536 Number of Sequences: 438 Number of extensions: 2562 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -