BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0049 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 4.6 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 23 6.1 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 4.6 Identities = 13/54 (24%), Positives = 25/54 (46%) Frame = +1 Query: 406 TILV*RSNRLECEFFNSLSNKSNVSPNYNRALNPXXXXXKVKTNCTRVHNAYMY 567 TI + L F ++ SN S ++ ++ + P + T C +++YMY Sbjct: 3090 TITCYEQHGLSYVFPHNTSNISGITEDHYSSCYPIEYNGLLTTACAGTNSSYMY 3143 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 23.4 bits (48), Expect = 6.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 616 CAFVCVNTLYTYDVSLYTCKRYVLAY 539 CA V L Y+ LY C+ Y+ Y Sbjct: 9 CAIAKVFELVIYNNLLYACRSYLSPY 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,451 Number of Sequences: 2352 Number of extensions: 11812 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -