BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0049 (637 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF036704-3|AAB88559.2| 503|Caenorhabditis elegans Hypothetical ... 29 2.8 Z72508-8|CAA96640.2| 366|Caenorhabditis elegans Hypothetical pr... 28 6.4 >AF036704-3|AAB88559.2| 503|Caenorhabditis elegans Hypothetical protein ZK185.2 protein. Length = 503 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/37 (32%), Positives = 25/37 (67%) Frame = +2 Query: 416 FSDLTVSSVSFLILCRIKVTSPLIITEHLIRVXDVVK 526 F + T ++SF+++C I+VT+ L I + L+R +++ Sbjct: 417 FHNTTPFTISFVLVCAIQVTTLLYICQILVRAMWIMR 453 >Z72508-8|CAA96640.2| 366|Caenorhabditis elegans Hypothetical protein F28H7.9 protein. Length = 366 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 526 VKTNCT-RVHNAYMYRVRHRMYTMCSRIQTHNHVHT 630 + T C R+HN+Y H +Y++ R Q ++ T Sbjct: 192 IVTKCNIRLHNSYSTLEHHGLYSLSERFQVSENIKT 227 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,800,941 Number of Sequences: 27780 Number of extensions: 263277 Number of successful extensions: 501 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -