BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0046 (719 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43255.1 68415.m05376 expressed protein 31 1.0 At3g27260.1 68416.m03407 DNA-binding bromodomain-containing prot... 27 9.5 >At2g43255.1 68415.m05376 expressed protein Length = 214 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 536 HTWP*STRKDTHTLPTGGTLALSLLPVDYFTNLASLLTQGGYSLW 670 HT T+K + GT+A++L P +LA ++T+G W Sbjct: 16 HTMGVDTKKSLEIIHLRGTVAVNLRPYTKIEDLADMMTKGAKYAW 60 >At3g27260.1 68416.m03407 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 813 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 696 KVVLS*SGVQSEYPPCVSSDAKLVK*STGSKLSAKV 589 K+VL + +Q P VSS + V STG K+S++V Sbjct: 91 KIVLKNAELQRMNPAAVSSTSDRVGFSTGQKISSRV 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,241,178 Number of Sequences: 28952 Number of extensions: 344209 Number of successful extensions: 743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -