BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0044 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67160.1 68414.m07640 F-box family protein similar to F-box p... 31 0.51 >At1g67160.1 68414.m07640 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 450 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -2 Query: 652 VDIKLGLLLQQDQKNDVFKFRSVNNIVIAPAKTGSDNNNKNAVIPTAHQ 506 ++I +L D+ D F F ++++ V K G DNN+ + P HQ Sbjct: 154 IEIDKAVLWVDDKSRDYFVFCNLSSYVAYHHKRGDDNNSWKVLQPIKHQ 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,395,267 Number of Sequences: 28952 Number of extensions: 162402 Number of successful extensions: 296 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -