BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0042 (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 24 1.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 3.7 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 8.6 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = -2 Query: 427 RVLAFFSRSIEEXFAKPGRFTVSIEK*APMAKYWIDAATSSWICFLIML 281 RVL + + F+ P F ++ M + WID T W ++ ++ Sbjct: 162 RVLVMLAWLLSILFSLPTVFLFEEKQVQSMPQCWIDLQTWQWKVYITLV 210 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +1 Query: 493 VQGPRHTSWESGASALEHALKLESDVTNSIREVIKTCE 606 ++GP+ +W+ + + +V +S R+ TCE Sbjct: 101 IRGPKRKTWKVEEDSPSPTSSVSPEVKDSSRDRPFTCE 138 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = +1 Query: 568 VTNSIREVIKTCESSFNDL 624 V ++++ V+KT S+F+D+ Sbjct: 387 VLHTVKTVLKTTMSTFSDI 405 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,695 Number of Sequences: 336 Number of extensions: 2494 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -