BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0042 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012) 33 0.20 SB_27133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_29575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_27134| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_7534| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018) 29 4.2 SB_11767| Best HMM Match : Kinesin (HMM E-Value=0) 28 7.4 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 28 7.4 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 27 9.8 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 27 9.8 >SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +3 Query: 270 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAXY 392 + C + KQI E+ AS YL+M +F D V PGF Y Sbjct: 197 EECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKY 237 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 374 PRLREXFFDAATEEREHATKLIDYLLMRG 460 P + F A+ EEREHA KL+ + RG Sbjct: 232 PGFHKYFLKASHEEREHAEKLMKFQNERG 260 >SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012) Length = 126 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 288 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGF 383 + KQI +E+ A YL+M +F D +N PGF Sbjct: 38 INKQINKELYAHYTYLSMAFHFDRDDINLPGF 69 >SB_27133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 32.3 bits (70), Expect = 0.34 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 374 PRLREXFFDAATEEREHATKLIDYLLMRG 460 P + F +A+ EEREHA KL + L RG Sbjct: 179 PGFHKYFMEASHEEREHAEKLAKFQLQRG 207 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 288 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAXY 392 + KQI E+ AS Y++M +F D V PGF Y Sbjct: 150 VNKQINLELYASYVYMSMAFHFDRDDVALPGFHKY 184 >SB_29575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 31.9 bits (69), Expect = 0.46 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 270 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGF 383 + C + KQI E+ AS Y +M YF + V+ PGF Sbjct: 10 EECEAGINKQINLELYASYVYTSMACYFDREDVHLPGF 47 >SB_27134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 288 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAXY 392 + KQI E+ AS Y++M +F D V PGF Y Sbjct: 135 VNKQINLELYASYVYMSMAYHFDRDDVALPGFHKY 169 Score = 31.1 bits (67), Expect = 0.80 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 374 PRLREXFFDAATEEREHATKLIDYLLMRG 460 P + F A+ EEREHA KL + L RG Sbjct: 164 PGFHKYFMKASHEEREHAEKLAKFQLQRG 192 >SB_7534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 288 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAXY 392 + KQI E+ AS Y++M +F D V PGF Y Sbjct: 18 VNKQINLELYASYVYMSMAFHFDRDDVALPGFHKY 52 Score = 31.1 bits (67), Expect = 0.80 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 374 PRLREXFFDAATEEREHATKLIDYLLMRG 460 P + F A+ EEREHA KL + L RG Sbjct: 47 PGFHKYFIKASHEEREHAEKLAKFQLQRG 75 >SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018) Length = 1066 Score = 28.7 bits (61), Expect = 4.2 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 5/77 (6%) Frame = +2 Query: 347 LLLDRYGEPPRLREXFFD-----AATEEREHATKLIDYLLMRGKLTGSVTNLITYRAPAT 511 +L DRYG+P R+ E + + E + D+L+M + SV L + + + Sbjct: 398 ILKDRYGDPFRIYEAYREKLNAWPVCTTSEELQEYSDFLVMTQETMKSVRYLKKFDSFSA 457 Query: 512 RRGRAAHQPSSTPSSWR 562 R A P+ + WR Sbjct: 458 TRDLAVRLPTYYENKWR 474 >SB_11767| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1230 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 308 GSGRVNPV--LSHGGLLLDRYGEPPRLREXFFDAATEERE 421 GSG+ + L GGL+ D+YG PR + F A E ++ Sbjct: 672 GSGKTYTIGGLDTGGLMDDQYGIIPRAVKQIFQAFEESKQ 711 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 407 TEEREHATKLIDYLLMRGKLTGSVTNLITYRAPATRRG 520 ++ RE A + I L+ LTGS T +I R P RG Sbjct: 1841 SDHREQAAQEIQAFLLDMILTGSKTEIIELRGPDKPRG 1878 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 287 DEETDPGGSGRVNPVLSHGGLLLDRYGEP 373 D DPGG R++ + HGG +DR G P Sbjct: 226 DRPMDPGGP-RMDHPMGHGGPPMDRGGPP 253 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 484 PHHVQGPRHTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDLPP 630 P+H+ G TSWE A + + N+ R I+ + S PP Sbjct: 356 PYHLAGTSRTSWECHNEASLSRAYWVNQLLNTFRNNIRNRKDSMPPRPP 404 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,798,647 Number of Sequences: 59808 Number of extensions: 342056 Number of successful extensions: 785 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -