BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0041 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) 30 2.0 SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) Length = 601 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 1 GRSRTSFLVTMMWKTVLITIFAAGVLADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTF 180 G FL + ++++ GV D +S I +V N A D + EVE A R Sbjct: 278 GGKAVKFLKVLKGAGAVLSVIGIGV--DLYSIINTLVECDKKSNQAADAIKEVEKAEREV 335 Query: 181 GNCLKGLVDLNV-LKTEIEE 237 L D N LKT + E Sbjct: 336 SKSETELRDFNTELKTFMRE 355 >SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 181 GNCLKGLVDLNVLKTEIEE 237 GNCLKG+V++NV IE+ Sbjct: 277 GNCLKGIVNVNVSPNIIEQ 295 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,295,703 Number of Sequences: 59808 Number of extensions: 423285 Number of successful extensions: 1102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -