BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0040 (712 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 27 0.15 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 1.9 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 3.2 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.7 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 7.5 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 27.1 bits (57), Expect = 0.15 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 261 LVQICKMAQVYPHPASEGCTSASSESAPSDQPIYPDTG 374 L + ++ VYP+ C + E++ SD P +P G Sbjct: 182 LETLSQLMDVYPNNDGTKCLVVTDEASISDAPFFPHRG 219 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 498 TKEANTIRSGTNTVTKLVEK 557 TK ANTIRS T+ + + EK Sbjct: 79 TKSANTIRSFTHVESPIDEK 98 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 503 RGQHHPIRHKHSHQAGREEE 562 RG+H+ R K + GRE++ Sbjct: 207 RGRHNQSRSKRQPKTGREDQ 226 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 627 LCRKMGVTILHCQGANPAFGALVH 698 LC++ GV + G A+G L+H Sbjct: 408 LCKESGVVKAYGAGLLSAYGELLH 431 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 289 TWAILQIWTSHDWLNALTNSKVLWPLLEE-RIHNFLGLN 176 TW L IWT A T + P+ E I LG+N Sbjct: 475 TWITLHIWTPKCERLARTEKLFVTPMYEGLLIDQSLGMN 513 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 289 TWAILQIWTSHDWLNALTNSKVLWPLLEE-RIHNFLGLN 176 TW L IWT A T + P+ E I LG+N Sbjct: 475 TWITLHIWTPKCERLARTEKLFVTPMYEGLLIDQSLGMN 513 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 289 TWAILQIWTSHDWLNALTNSKVLWPLLEE-RIHNFLGLN 176 TW L IWT A T + P+ E I LG+N Sbjct: 475 TWITLHIWTPKCERLARTEKLFVTPMYEGLLIDQSLGMN 513 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 289 TWAILQIWTSHDWLNALTNSKVLWPLLEE-RIHNFLGLN 176 TW L IWT A T + P+ E I LG+N Sbjct: 475 TWITLHIWTPKCERLARTEKLFVTPMYEGLLIDQSLGMN 513 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 300 PASEGC-TSASSESAPSDQPIYPD 368 P + C ASS APS P+ PD Sbjct: 2279 PENTECHPDASSTMAPSTTPMVPD 2302 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +2 Query: 500 QRGQHHPIRHKHSHQAGREEEGA 568 Q QHH H+ H ++GA Sbjct: 174 QHPQHHQPHHQQQHMMYGGQQGA 196 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +2 Query: 500 QRGQHHPIRHKHSHQAGREEEGA 568 Q QHH H+ H ++GA Sbjct: 176 QHPQHHQPHHQQQHMMYGGQQGA 198 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,215 Number of Sequences: 336 Number of extensions: 3228 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -