BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0039 (441 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 2.1 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 22 8.4 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 323 MEIYFVLCNLNNHASKSLHTYF 258 M + F++CN +HASK + F Sbjct: 348 MSLLFIICNEAHHASKRVGLNF 369 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 22.2 bits (45), Expect = 8.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 344 LITNHNNTR*YCNI*FWLTLLFINRTEQVTVN 439 L+ N R C++ WL INRT V ++ Sbjct: 84 LLAKLNKVRFPCSLVQWLKSYLINRTYIVKID 115 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 364,653 Number of Sequences: 2352 Number of extensions: 5867 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -