BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0039 (441 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 25 0.49 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 6.0 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 24.6 bits (51), Expect = 0.49 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 398 LAKIKCYNIISYYYGL*LDLKFLVFMEIYFV 306 + KIK NII Y + + F++F IY++ Sbjct: 455 MPKIKDVNIIDKYSRIIFPVSFMLFNAIYWI 485 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 348 IRSEILSFHGNLFCSLQFE*P 286 ++ E+ S N C L+FE P Sbjct: 642 LKEEVSSIETNYECGLRFEDP 662 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,456 Number of Sequences: 438 Number of extensions: 1964 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -