BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0038 (723 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC5E4.03c |taf72||transcription factor TFIID complex subunit 5... 28 1.2 SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein lig... 27 3.6 >SPCC5E4.03c |taf72||transcription factor TFIID complex subunit 5 Taf72|Schizosaccharomyces pombe|chr 3|||Manual Length = 643 Score = 28.3 bits (60), Expect = 1.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -1 Query: 690 WEAHLGHGLGVFRPSLSPLTTLNARGSGH 604 W+ H GH + VF P+T + GH Sbjct: 490 WDVHRGHSVRVFNGHTQPVTAVAIAPDGH 518 >SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1647 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/54 (24%), Positives = 22/54 (40%) Frame = +2 Query: 392 VINMASSDPEIKDGFTLPVWMKTKPTKEFEPFAGSPPPPKIHSSTYATLNRIYY 553 ++++ SS + LP P +E G PP H + T+ +YY Sbjct: 613 LLHIISSLCQSSSALILPFLNHNLPDVMYEMLCGIPPSDTSHQADMITMQSLYY 666 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,665,196 Number of Sequences: 5004 Number of extensions: 51991 Number of successful extensions: 151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -