BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0038 (723 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK131496-1|BAD18640.1| 177|Homo sapiens protein ( Homo sapiens ... 30 9.6 >AK131496-1|BAD18640.1| 177|Homo sapiens protein ( Homo sapiens cDNA FLJ16695 fis, clone TRACH3003683, moderately similar to Lactoperoxidase precursor (EC 1.11.1.7). ). Length = 177 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -1 Query: 705 LARCPWEAHLGHGLGVFRPSLSPLTTLNARGSGHFLR 595 LA W +HL H L + R SP + L GSG F R Sbjct: 123 LAHLGWRSHLPHLLKIARLQPSPSSPLCVSGSGTFPR 159 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,083,543 Number of Sequences: 237096 Number of extensions: 1758803 Number of successful extensions: 3966 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3951 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -