BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0037 (574 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 26 1.0 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 7.1 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 25.8 bits (54), Expect = 1.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 229 ESSVSLCHSLSALIASPNCC 288 +S V +C+S+ +A+ NCC Sbjct: 37 QSRVEMCNSVRTALAASNCC 56 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 7.1 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = +3 Query: 213 KSIYSRIISQPMSLSL---GADRVSKLLLDVSPTKFVFLAQTPFVKVIDLEGTVDVQSKA 383 + +YS P+S +L +R KL ++PT + F ++D+ +D Sbjct: 104 RGVYSNEEVDPLSANLFFLEGNRWGKLRSKLAPTFTSGKLKAMFHTIVDVGNRLDQHLAE 163 Query: 384 KTQQAK 401 K QQ K Sbjct: 164 KCQQVK 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,323 Number of Sequences: 2352 Number of extensions: 10703 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -