BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0036 (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 29 0.024 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 29.5 bits (63), Expect = 0.024 Identities = 13/73 (17%), Positives = 27/73 (36%) Frame = +2 Query: 359 IHWMASWDTEISFKETWIHRETFFRAGLAAVASFVAGXVNPVEISERLGYLLKGNGSKNP 538 I W + D + WI E+ + ++ V+ + + + E + +P Sbjct: 182 IKWSPNEDYSCEYNLVWIKEESIYEERISVVSGLHEATLTDLALGENYTVQIMAKSESSP 241 Query: 539 VEGMALASAFSTP 577 E + + F TP Sbjct: 242 FESLKKSLNFRTP 254 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -2 Query: 271 VCPIPNIFEGSFTHLPGPPSR 209 VC P EG H PP++ Sbjct: 959 VCDWPENVEGCMQHTAAPPTK 979 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,934 Number of Sequences: 336 Number of extensions: 2707 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -