BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0035 (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 6.9 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 6.9 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 21 6.9 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 21 6.9 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 21 9.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.1 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 653 LHLQPSNSLITFSSLTIANTWSST 582 +HL ++ L+TF + + W+ST Sbjct: 93 MHLAIADLLVTFLMMPLEIGWAST 116 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 653 LHLQPSNSLITFSSLTIANTWSST 582 +HL ++ L+TF + + W+ST Sbjct: 93 MHLAIADLLVTFLMMPLEIGWAST 116 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 72 LKHALRYYRHLFASLL 25 L+ LRY+ +F+SLL Sbjct: 84 LQQKLRYFEEVFSSLL 99 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 72 LKHALRYYRHLFASLL 25 L+ LRY+ +F+SLL Sbjct: 84 LQQKLRYFEEVFSSLL 99 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 21.0 bits (42), Expect = 9.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 277 RISYQTSES*RNSRTGSRRELRCA 348 RIS + ES N R R+L+CA Sbjct: 29 RISDEAIESTLNDRRYLLRQLKCA 52 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = -3 Query: 249 RIPVPEICSGRTMEHRIQLKCTPWLKLQFQS*LYSKRAHFLQ 124 + P+ E+ S ++ + IQ++C + F A+FL+ Sbjct: 59 KFPIQELKSQESLLNSIQIRCIESNMISFYLEATDDFAYFLE 100 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,234 Number of Sequences: 336 Number of extensions: 2650 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -