BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0035 (665 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 83 2e-16 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 80 2e-15 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 80 2e-15 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 79 2e-15 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 79 2e-15 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 76 2e-14 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 68 5e-12 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 65 3e-11 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 62 2e-10 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 62 2e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 59 2e-09 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 52 3e-07 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 52 3e-07 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 43 2e-04 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 42 3e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 41 9e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 41 9e-04 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 40 0.001 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 38 0.008 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 37 0.010 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.010 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.010 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 37 0.014 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.014 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 37 0.014 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 36 0.024 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.024 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 35 0.042 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 35 0.042 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 35 0.042 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 35 0.042 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 34 0.074 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 33 0.13 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 33 0.17 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 33 0.17 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 33 0.23 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 33 0.23 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 33 0.23 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.23 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 33 0.23 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 33 0.23 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 33 0.23 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 33 0.23 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 32 0.30 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 32 0.30 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 32 0.39 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 32 0.39 At3g19780.1 68416.m02504 expressed protein 31 0.52 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 31 0.52 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.52 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 0.69 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 31 0.91 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.91 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 31 0.91 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 31 0.91 At1g26680.1 68414.m03250 transcriptional factor B3 family protei... 30 1.2 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 1.6 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 30 1.6 At5g18120.1 68418.m02127 expressed protein 29 2.1 At4g05490.1 68417.m00830 F-box family protein (FBL22) contains s... 29 3.7 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 4.9 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 6.4 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 8.5 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 82.6 bits (195), Expect = 2e-16 Identities = 38/87 (43%), Positives = 64/87 (73%), Gaps = 4/87 (4%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQAD 418 +AA++L+ P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ Sbjct: 70 KAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAE 129 Query: 419 DIISWLKKKTGPPAVEVTSAEQAKELI 499 I+++LKK++GP +VE+ SA+ A E++ Sbjct: 130 GIVTYLKKQSGPASVEIKSADSATEVV 156 Score = 66.5 bits (155), Expect = 1e-11 Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +3 Query: 75 FTAIALLGLALGD--EVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 248 F+ + LL L + T+E VL L +NF IS ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 249 AK 254 K Sbjct: 69 EK 70 Score = 47.6 bits (108), Expect = 7e-06 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 117 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAP 242 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/60 (28%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +2 Query: 272 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 448 + + + +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 420 QNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 79.8 bits (188), Expect = 2e-15 Identities = 36/82 (43%), Positives = 58/82 (70%) Frame = +2 Query: 254 AATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISW 433 AAT+L E+ + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W Sbjct: 145 AATELKEDG--VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTW 202 Query: 434 LKKKTGPPAVEVTSAEQAKELI 499 +KKK GP +T+ + A++++ Sbjct: 203 VKKKIGPGVYNLTTLDDAEKVL 224 Score = 71.3 bits (167), Expect = 5e-13 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +3 Query: 93 LGLALGDEVPT----EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYA 143 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 3/51 (5%) Frame = +3 Query: 111 DEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNK 483 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 79.8 bits (188), Expect = 2e-15 Identities = 36/82 (43%), Positives = 58/82 (70%) Frame = +2 Query: 254 AATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISW 433 AAT+L E+ + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W Sbjct: 145 AATELKEDG--VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTW 202 Query: 434 LKKKTGPPAVEVTSAEQAKELI 499 +KKK GP +T+ + A++++ Sbjct: 203 VKKKIGPGVYNLTTLDDAEKVL 224 Score = 71.3 bits (167), Expect = 5e-13 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +3 Query: 93 LGLALGDEVPT----EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYA 143 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 3/51 (5%) Frame = +3 Query: 111 DEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNK 483 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/87 (41%), Positives = 62/87 (71%), Gaps = 4/87 (4%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQAD 418 +AA+ L+ P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ Sbjct: 71 KAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAE 130 Query: 419 DIISWLKKKTGPPAVEVTSAEQAKELI 499 I+++LKK++GP + E+ SA+ A E++ Sbjct: 131 GIVTYLKKQSGPASAEIKSADDASEVV 157 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 4/71 (5%) Frame = +3 Query: 54 IAMRVLIFTAIALLGLALG----DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCG 221 +AMR +I +L L +E T+E VL L NF I+ ++I+VEFYAPWCG Sbjct: 1 MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG 60 Query: 222 HCKSLAPEYAK 254 HCK LAPEY K Sbjct: 61 HCKQLAPEYEK 71 Score = 48.4 bits (110), Expect = 4e-06 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +3 Query: 117 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAP 242 +P E N +V+S + + V+++ + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/57 (28%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +2 Query: 272 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 439 + +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 422 QSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/87 (41%), Positives = 62/87 (71%), Gaps = 4/87 (4%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQAD 418 +AA+ L+ P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ Sbjct: 71 KAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAE 130 Query: 419 DIISWLKKKTGPPAVEVTSAEQAKELI 499 I+++LKK++GP + E+ SA+ A E++ Sbjct: 131 GIVTYLKKQSGPASAEIKSADDASEVV 157 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 4/71 (5%) Frame = +3 Query: 54 IAMRVLIFTAIALLGLALG----DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCG 221 +AMR +I +L L +E T+E VL L NF I+ ++I+VEFYAPWCG Sbjct: 1 MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG 60 Query: 222 HCKSLAPEYAK 254 HCK LAPEY K Sbjct: 61 HCKQLAPEYEK 71 Score = 48.4 bits (110), Expect = 4e-06 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +3 Query: 117 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAP 242 +P E N +V+S + + V+++ + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 4/78 (5%) Frame = +2 Query: 272 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK- 445 + +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 422 QSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNK 481 Query: 446 --TGPPAVEVTSAEQAKE 493 G P E + E+ K+ Sbjct: 482 DTVGEPKKEEETTEEVKD 499 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 76.2 bits (179), Expect = 2e-14 Identities = 31/84 (36%), Positives = 53/84 (63%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 430 +AAT L E S + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ Sbjct: 118 EAATALKEIGSSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVI 177 Query: 431 WLKKKTGPPAVEVTSAEQAKELID 502 W++KKTG P + + + ++A +D Sbjct: 178 WVQKKTGAPIITLNTVDEAPRFLD 201 Score = 33.9 bits (74), Expect = 0.098 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 135 VLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 VL L+ + VI E+++V YAPWC L P +A+ Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAE 118 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 68.1 bits (159), Expect = 5e-12 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +2 Query: 293 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEV 469 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 470 TSAEQAKELIDA 505 T+ E+A+ ++ A Sbjct: 211 TTKEEAERVLSA 222 Score = 57.6 bits (133), Expect = 7e-09 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = +3 Query: 126 EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 E++V VL+K NF + + +VEFYAPWCG C++L PEYA Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYA 139 Score = 46.8 bits (106), Expect = 1e-05 Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = +3 Query: 48 DNIAMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWC 218 +NI F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 219 GHCKSLAPEYAK 254 GHC+S P Y K Sbjct: 468 GHCQSFEPIYNK 479 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 65.3 bits (152), Expect = 3e-11 Identities = 27/79 (34%), Positives = 50/79 (63%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 430 +AAT L E S + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ Sbjct: 116 EAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVI 175 Query: 431 WLKKKTGPPAVEVTSAEQA 487 W++KKTG +++ + ++A Sbjct: 176 WVQKKTGASTIKLDTVDEA 194 Score = 36.3 bits (80), Expect = 0.018 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 135 VLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 V+ L+ N + +I EY++V YAPWC L P +A+ Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAE 116 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 62.5 bits (145), Expect = 2e-10 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +3 Query: 72 IFTAIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 252 K 254 K Sbjct: 64 K 64 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 129 ENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEK 183 Score = 60.1 bits (139), Expect = 1e-09 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 424 + AT +EE + +A +DA + L E YGV G+PTLKFF N + DY GGR DD Sbjct: 183 KVATVFKQEEGVV-IANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDF 241 Query: 425 ISWLKKKTG 451 +S++ +K+G Sbjct: 242 VSFINEKSG 250 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 287 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 451 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 62.5 bits (145), Expect = 2e-10 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +3 Query: 72 IFTAIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 252 K 254 K Sbjct: 64 K 64 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 129 ENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEK 183 Score = 60.1 bits (139), Expect = 1e-09 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 424 + AT +EE + +A +DA + L E YGV G+PTLKFF N + DY GGR DD Sbjct: 183 KVATVFKQEEGVV-IANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDF 241 Query: 425 ISWLKKKTG 451 +S++ +K+G Sbjct: 242 VSFINEKSG 250 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 287 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 451 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = +3 Query: 111 DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPE 245 D+ + VL L+ +NF++ IST + I V+FYAPWCGHCK L PE Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPE 70 Score = 57.6 bits (133), Expect = 7e-09 Identities = 28/83 (33%), Positives = 47/83 (56%) Frame = +2 Query: 254 AATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISW 433 AA LA+ + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ + Sbjct: 74 AAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRY 133 Query: 434 LKKKTGPPAVEVTSAEQAKELID 502 LKK P + S KE ++ Sbjct: 134 LKKFVAPDVAVLESDSTVKEFVE 156 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/38 (57%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 144 LSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 L+ +NF E V + E +VEF+APWCGHCK LAPE+ K Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKK 205 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 135 VLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAK 254 VL L+ +NF++ V+++ +LVEF+APWCGHC+SL P + K Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEK 70 Score = 47.6 bits (108), Expect = 7e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 293 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 445 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 39.1 bits (87), Expect = 0.003 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +2 Query: 287 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LKKKT 448 +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ L+ Sbjct: 214 VKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNA 273 Query: 449 GPPAVEVTSAEQAKELIDANLLLYLVSF 532 GP V + E + + VSF Sbjct: 274 GPAEVTELTGPDVMEDKCGSAAICFVSF 301 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 144 LSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAK 254 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ + Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKR 204 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/41 (48%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 135 VLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAK 254 V+ L+ +NF++ V+++ +LVEF+APWCGHCK+L P + K Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEK 72 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 293 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 445 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +2 Query: 278 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKK--K 445 + +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ + + Sbjct: 210 QGKVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVE 269 Query: 446 TGPPAVEVT 472 + VEVT Sbjct: 270 SSAGPVEVT 278 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 42.7 bits (96), Expect = 2e-04 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 2/75 (2%) Frame = +3 Query: 51 NIAMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVISTTEYILVEFYAPWCGH 224 +I RV T IA L L + + ++ L S +E +S + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 225 CKSLAPEYAKQQQSW 269 C+ LAP+ K +Q + Sbjct: 153 CRELAPDVYKIEQQY 167 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 272 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 391 E + + LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 194 EMDGRVILAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 Score = 40.7 bits (91), Expect = 9e-04 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 108 GDEVPTE--ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAK 254 GDE E E+ + L+ NF+T ++V FYAPWC C L P + K Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEK 182 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 40.7 bits (91), Expect = 9e-04 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 126 EENVLVLSKANFETVI--STTEYILVEFYAPWCGHCKSLAPEYAK 254 ++N + L+ NF++V S +Y ++EF+A WC C++ P Y K Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEK 84 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 40.7 bits (91), Expect = 9e-04 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 126 EENVLVLSKANFETVI--STTEYILVEFYAPWCGHCKSLAPEYAK 254 ++N + L+ NF++V S +Y ++EF+A WC C++ P Y K Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEK 84 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 126 EENVLVLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEYAK 254 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEK 78 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.5 bits (83), Expect = 0.008 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +3 Query: 123 TEENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAP 242 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 37.1 bits (82), Expect = 0.010 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 10/71 (14%) Frame = +2 Query: 272 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADD 421 E + + L VD T+E L + ++GYP+++ FR GS + Y G R D Sbjct: 194 EADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDS 253 Query: 422 IISWLKKKTGP 454 I+ ++ P Sbjct: 254 IVKMVEGLVAP 264 Score = 33.9 bits (74), Expect = 0.098 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 78 TAIALLGLALGDEVPTE--ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 252 K 254 K Sbjct: 182 K 182 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.010 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +3 Query: 144 LSKANFET-VISTTEYILVEFYAPWCGHCKSLAP 242 LS + ++T V+ + +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 290 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 394 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 299 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 451 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 36.7 bits (81), Expect = 0.014 Identities = 26/79 (32%), Positives = 38/79 (48%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 430 Q + LA + +V+A + +++E+Y V P FF++G +D G AD S Sbjct: 41 QVFSHLATDFPRAHFFRVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--S 96 Query: 431 WLKKKTGPPAVEVTSAEQA 487 L K G A TSAE A Sbjct: 97 SLANKVGKVAGSSTSAEPA 115 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.7 bits (81), Expect = 0.014 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +2 Query: 287 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 436 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 437 KKKTGP 454 ++ P Sbjct: 260 EELLKP 265 Score = 33.9 bits (74), Expect = 0.098 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 144 LSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKQQQ 263 L+ A FE + ++V FYAPWC L P + K Q Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQ 186 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 36.7 bits (81), Expect = 0.014 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 123 TEENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAP 242 T + V++ + +++ V+ E + V+F+APWCG CK + P Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDP 112 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = +2 Query: 206 CSMVRPLQISGTGIRQAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS 385 C M+ P+ + + A K A + K K++ + YGVR PT+ F NG Sbjct: 107 CKMIDPI------VNELAQKYAGQ---FKFYKLNTDESPATPGQYGVRSIPTIMIFVNGE 157 Query: 386 PIDYSGGRQADDIIS 430 D G + D ++ Sbjct: 158 KKDTIIGAVSKDTLA 172 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.9 bits (79), Expect = 0.024 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 165 TVISTTEYILVEFYAPWCGHCKSLAPEYAKQQQSW 269 TV+ + + +LVEF A WCG CK + P Q + Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEY 116 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 338 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 487 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.1 bits (77), Expect = 0.042 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +3 Query: 114 EVPTEENVLVLSKANF--ETVISTTEYILV-EFYAPWCGHCKSLAPE 245 E T N+L + AN +++++ + ++V +FY+P CG CKSL P+ Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPK 126 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 35.1 bits (77), Expect = 0.042 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 260 TKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 394 + LA + S + KVD + D+A S+ + PT F R+G +D Sbjct: 315 SNLATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 150 KANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 251 +A + + +++ F A WCG C+ ++P Y+ Sbjct: 282 EAKTKAAKKASRLLILYFTATWCGPCRYMSPLYS 315 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 35.1 bits (77), Expect = 0.042 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 150 KANFETVISTTEYILVEFYAPWCGHCKSLAPE 245 K+ + T + +++EF A WCG CK+L P+ Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPK 80 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 35.1 bits (77), Expect = 0.042 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 114 EVPTEENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEY 248 E+ NV+ LSK E ++ + E LV YAPWC C+++ Y Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASY 384 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 34.3 bits (75), Expect = 0.074 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +2 Query: 263 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 442 ++A++ + + K+D + Q +A+ + V PT F + G+ ID G D+I L K Sbjct: 51 EMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMK 110 Query: 443 KTG 451 G Sbjct: 111 HGG 113 Score = 29.1 bits (62), Expect = 2.8 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYAKQQQSW 269 I+++F A WC C+ +AP +A+ + + Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKKF 56 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/51 (25%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 123 TEENVLVLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEYAKQQQSW 269 T V + K F ++ + ++++ Y WCG CK +AP+Y + + + Sbjct: 76 TVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKY 126 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 263 KLAEEESPIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 430 +L+E+ + K+D Q+ + LA+ G+R PT K ++ + G + +D+++ Sbjct: 121 ELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLA 177 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 33.1 bits (72), Expect = 0.17 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYAK 254 ++V+FY WCG C+++ P+ K Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCK 137 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 431 WLKKKTGPPAVEVTSAEQ-AKELIDANLLLYLVSF 532 W ++K GP +++TSAEQ L DA L +V F Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDF 120 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 33.1 bits (72), Expect = 0.17 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +3 Query: 150 KANFETVISTTEYILVEFYAPWCGHCKSLAP 242 K+ F+++ + + ++++F A WCG CK++ P Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEP 63 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 32.7 bits (71), Expect = 0.23 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYAK 254 ++VEFY WC C++L P+ K Sbjct: 126 VIVEFYGTWCASCRALFPKLCK 147 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 32.7 bits (71), Expect = 0.23 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYAK 254 ++VEFY WC C++L P+ K Sbjct: 126 VIVEFYGTWCASCRALFPKLCK 147 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/59 (25%), Positives = 30/59 (50%) Frame = +2 Query: 266 LAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 442 LA++ + KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 53 LAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 Score = 31.1 bits (67), Expect = 0.69 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYA 251 ++V+F A WCG C+ +AP +A Sbjct: 31 VVVDFTASWCGPCRFIAPFFA 51 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.23 Identities = 9/27 (33%), Positives = 20/27 (74%) Frame = +3 Query: 162 ETVISTTEYILVEFYAPWCGHCKSLAP 242 + ++++ + +LV++YA WCG C+ + P Sbjct: 75 DLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.3 bits (70), Expect = 0.30 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 287 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 427 I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.7 bits (71), Expect = 0.23 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 156 NFETVISTTEY-ILVEFYAPWCGHCKSLAP 242 +F+ ++ ++ +LV+FYA WCG C+ + P Sbjct: 67 SFDDLLQNSDKPVLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 287 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 427 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 263 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 439 K E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 440 KKTGPPAVEVTSAEQAKEL 496 ++T A E E KEL Sbjct: 130 EET-EKAAEKAQLED-KEL 146 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 135 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSL 236 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 263 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 439 K E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 440 KKTGPPAVEVTSAEQAKEL 496 ++T A E E KEL Sbjct: 130 EET-EKAAEKAQLED-KEL 146 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 135 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSL 236 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 263 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 439 K E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 440 KKTGPPAVEVTSAEQAKEL 496 ++T A E E KEL Sbjct: 130 EET-EKAAEKAQLED-KEL 146 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 135 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSL 236 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 32.3 bits (70), Expect = 0.30 Identities = 24/103 (23%), Positives = 45/103 (43%), Gaps = 3/103 (2%) Frame = +2 Query: 251 QAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 430 Q + LA + +V+A + +++E+Y V P FF++G +D G + + Sbjct: 41 QVFSHLATDFPRAHFFRVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLAN 100 Query: 431 WLKKKTG---PPAVEVTSAEQAKELIDANLLLYLVSFRTRAQP 550 + K G P ++ + + E + N S + RAQP Sbjct: 101 KVGKVAGSITPASLGLAAGPTILETVKKNA---KASGQDRAQP 140 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 32.3 bits (70), Expect = 0.30 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEY 248 ++++ Y WCG CK +AP+Y Sbjct: 90 VVLDMYTQWCGPCKVIAPKY 109 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 266 LAEEESPIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 430 L+E+ + K+D + + LA+ G+R PT K ++ + G + DD+++ Sbjct: 112 LSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVA 167 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 31.9 bits (69), Expect = 0.39 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +3 Query: 96 GLALGDEVPTEENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEY 248 G A ++ ENV+ LS+ E ++ + E +V YAPWC C+++ + Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASF 388 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +3 Query: 129 ENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEY 248 EN++ LS+ E ++ + E +V YAPWC C+++ Y Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASY 395 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 31.5 bits (68), Expect = 0.52 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 141 VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKQQQ 263 +L++ NF + I ++L+ PWCG +SL E + Q Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQ 69 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 31.5 bits (68), Expect = 0.52 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 263 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 391 +L+E+ S + VD + D + S+ ++ PT F +NG I Sbjct: 69 ELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQI 111 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAP 242 ++ F A WCG CK +AP Sbjct: 48 VVANFSATWCGPCKIVAP 65 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.5 bits (68), Expect = 0.52 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 162 ETVISTTEYILVEFYAPWCGHCK 230 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 31.1 bits (67), Expect = 0.69 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = +2 Query: 266 LAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 442 LA++ + KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 52 LAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYA 251 I+++F A WC C+ +AP +A Sbjct: 30 IVIDFTATWCPPCRFIAPVFA 50 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 30.7 bits (66), Expect = 0.91 Identities = 14/60 (23%), Positives = 29/60 (48%) Frame = +2 Query: 245 IRQAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 424 I A +A++ + + K+D + D+A+ + V PT + G I+ G + D++ Sbjct: 65 IEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDEL 124 Score = 30.3 bits (65), Expect = 1.2 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 156 NFETVISTTEYILVEFYAPWCGHCKSLAP 242 +F + + + ++V+F A WCG C+ + P Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEP 67 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 0.91 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 338 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 451 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 30.7 bits (66), Expect = 0.91 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPEYAK 254 ++V+F++P CG CK+L P+ K Sbjct: 116 VVVDFFSPSCGGCKALHPKICK 137 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 30.7 bits (66), Expect = 0.91 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 174 STTEYILVEFYAPWCGHCKSLAPEYAKQQQSW 269 S T +++V F A WCG C+ + P K + Sbjct: 225 SQTPHVMVMFTARWCGPCRDMIPILNKMDSEY 256 >At1g26680.1 68414.m03250 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 920 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 285 GDSSSASFVAAWRIPVPEICSGRTMEHRIQLKCT 184 GDS V W+ PV +C ++ H+ L+C+ Sbjct: 340 GDSFKFKLVGTWKKPVLSLCPTQSNNHKTPLECS 373 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -3 Query: 285 GDSSSASFVAAWRIPVPEICSGRTMEHRIQLKCT 184 GDS V W PV +C T H+ L C+ Sbjct: 510 GDSFKFKLVGTWNKPVLSLCPTETNYHKTPLACS 543 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 189 ILVEFYAPWCGHCKSLAPE 245 ++V+FYA WCG C +A E Sbjct: 97 LIVDFYATWCGPCILMAQE 115 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 272 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 388 E ES + KVD E + A VRG PTL FF + P Sbjct: 122 EYESNAIIVKVDTDDEYEFARDMQVRGLPTL-FFISPDP 159 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = +3 Query: 126 EENVLVLSKANFETVISTT----EYILVEFYAPWCGHCKSLAPE 245 ++N+ +S A E V S T + ++V+F++P CG CK+L P+ Sbjct: 96 KDNMREISSAQ-ELVDSLTNAGDKLVVVDFFSPGCGGCKALHPK 138 >At5g18120.1 68418.m02127 expressed protein Length = 289 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Frame = +2 Query: 338 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL-IDANLL 514 YG+ P++ + Y G + +I + K+ TG V+ + L D NL+ Sbjct: 120 YGIHSLPSILMVNQTMKMRYHGPKDLASLIQFYKETTGLKPVQYMDEGEPTSLDTDGNLI 179 Query: 515 LYL---VSFRTRAQPEP 556 +L S R A+ EP Sbjct: 180 TWLHNGSSIREIAEREP 196 >At4g05490.1 68417.m00830 F-box family protein (FBL22) contains similarity to N7 protein GI:3273101 from [Medicago truncatula] Length = 307 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 499 RCQSVIVFGFFSDQSSTRAKTFLSTAQVVDDQVFAIVSDEKVIKELEG 642 +C ++ +FG Q R K F V+DD + I SD I++ +G Sbjct: 237 QCFNINLFGDLERQCLERIKDFRCPNDVLDDYNYVIFSDNGSIEDEKG 284 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 302 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 424 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 501 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 400 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 302 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 391 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,504,351 Number of Sequences: 28952 Number of extensions: 257199 Number of successful extensions: 831 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -