BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0034 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 9.0 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 23 9.0 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +2 Query: 26 HQPTRRSAV*APRCCCERSTHLHVRRSPPHLPRKLSLRIGARP 154 H TR A AP+ +T +PP P L+ G +P Sbjct: 112 HTVTRTKATVAPKSTTTTTTVKPTTTTPPPCPPTLTTFNGGQP 154 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 403 IEANGFYLGKLRGLL 447 ++ NGFYLG+ R +L Sbjct: 58 LDDNGFYLGESRAIL 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,539 Number of Sequences: 2352 Number of extensions: 14522 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -