BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0033 (563 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q29BI1 Cluster: GA20459-PA; n=1; Drosophila pseudoobscu... 34 2.6 UniRef50_Q22ZC2 Cluster: Putative uncharacterized protein; n=1; ... 32 8.1 >UniRef50_Q29BI1 Cluster: GA20459-PA; n=1; Drosophila pseudoobscura|Rep: GA20459-PA - Drosophila pseudoobscura (Fruit fly) Length = 134 Score = 33.9 bits (74), Expect = 2.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 454 LPKKCSVGIKVITKFKKYASCCCS 383 +PKKC +G+ V+ KF K A C C+ Sbjct: 85 IPKKCLIGLPVVAKFPKPAPCGCN 108 >UniRef50_Q22ZC2 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1146 Score = 32.3 bits (70), Expect = 8.1 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -1 Query: 500 R*IFLLFVKTLTIKLTTQKMFCRNKSNYQVQ 408 R I+ LF+K L IKL T K++ ++K+ YQ++ Sbjct: 2 RTIWYLFLKFLAIKLVTHKLWYKSKTKYQLK 32 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,085,206 Number of Sequences: 1657284 Number of extensions: 7365623 Number of successful extensions: 15430 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15428 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37904934977 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -