BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0033 (563 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 25 5.8 SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|c... 25 7.7 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 25.4 bits (53), Expect = 5.8 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -1 Query: 488 LLFVKTLTIKLTTQKMFCRNKSNYQVQKIRI---VLL*FLGRISIHCLNYSRILRLKLRE 318 LLF + K+ ++FC N + + +LL R S HC N+++ L LRE Sbjct: 519 LLFDERSLFKIPYHELFCALLKNPDIISSSVKQSLLLDGFFRWSQHCSNFNKESMLSLRE 578 >SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 25.0 bits (52), Expect = 7.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 117 LSHYQLCSVICSLICYLI 64 LS Y LC V+C +C ++ Sbjct: 282 LSLYNLCKVLCGQMCLMV 299 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,948,052 Number of Sequences: 5004 Number of extensions: 34986 Number of successful extensions: 94 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -