BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0033 (563 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59105.1 68418.m07405 expressed protein 30 1.2 At5g06040.1 68418.m00669 self-incompatibility protein-related 28 5.0 At5g53610.1 68418.m06660 glycosyl hydrolase family protein 17 si... 27 8.7 >At5g59105.1 68418.m07405 expressed protein Length = 132 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 305 YPRVVL*VSIEEFVNNSNSVSIYDQGTTTTRC 400 +P VL ++ E+F NNSNS+ + +G C Sbjct: 7 HPLAVLVLTTEKFANNSNSIRVNAEGIEAALC 38 >At5g06040.1 68418.m00669 self-incompatibility protein-related Length = 111 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 156 LTNTKIINLDQFSLSHYQLCSVICSLICYLIVAI 55 + N+ IINL+ + S + + V+ SLIC L + I Sbjct: 1 MINSSIINLNSYVCSIFIMSIVVISLICSLALQI 34 >At5g53610.1 68418.m06660 glycosyl hydrolase family protein 17 similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 110 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 296 FCSYPRVVL*VSIEEFVNNSNSVSIYDQGTTTTRCVFFELGNYFYSD 436 FC YP +L FV NS S QG T C F G YSD Sbjct: 61 FCYYPNTLL--DHASFVMNSYYKS---QGRTYAACSFGNTGYLIYSD 102 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,490,937 Number of Sequences: 28952 Number of extensions: 159503 Number of successful extensions: 320 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 320 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -