BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0031 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 5.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.7 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 7.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 309 LLMATSNGSYRVQTF*ANYFLVLHKNLCGFLIA 211 L+ S + V+TF A F + KNL LIA Sbjct: 721 LIKFISIAKHNVRTFSAGGFFDIRKNLIFSLIA 753 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 618 VGHAGEPREQIRANAEEVLPGVVQLEAECAHERA 719 V AGE +I N E++ + + +ERA Sbjct: 660 VSKAGELIHKIETNDHEIIDKIEMFSLQILNERA 693 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 477 CENSNSSIPYFFMK 436 CEN+++ + +FF K Sbjct: 172 CENNSTGVEHFFKK 185 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,969 Number of Sequences: 336 Number of extensions: 3472 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -