BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0028 (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40270.1 68418.m04885 metal-dependent phosphohydrolase HD dom... 27 7.3 At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD fin... 27 9.6 >At5g40270.1 68418.m04885 metal-dependent phosphohydrolase HD domain-containing protein similar to SP|Q60710 Interferon-gamma inducible protein MG11 {Mus musculus}; contains Pfam profile PF01966: HD domain Length = 473 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -1 Query: 359 DLFS*MYTHSKVMYVKFI---NLIKCNNKLQFQS 267 DL+ +YTHSKV ++ + ++K NN L+ S Sbjct: 262 DLYRTVYTHSKVKAIELMIVDAMVKANNHLEISS 295 >At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD finger protein-related contains Pfam profiles PF03107: DC1 domain, weak hit to PF00628: PHD-finger Length = 513 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 54 NFTAYFLCIHYNR*KNTHRHS*DISFRKN-PL-IWHNTGLCR 173 NF A+ CIH + RH ISF + PL IW + G+CR Sbjct: 132 NFAAHSDCIHIPQTIRMSRHDHRISFTSSLPLGIW-SCGVCR 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,504,741 Number of Sequences: 28952 Number of extensions: 176583 Number of successful extensions: 207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -